[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35109.1
DDBJ      :             pyruvate ferredoxin oxidoreductase, gamma subunit
Swiss-Prot:PORC_THEMA   RecName: Full=Pyruvate synthase subunit porC;         EC=1.2.7.1;AltName: Full=Pyruvate oxidoreductase gamma chain;         Short=POR;AltName: Full=Pyruvic-ferredoxin oxidoreductase subunit gamma;

Homologs  Archaea  55/68 : Bacteria  93/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.64.1
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->192 2raaA PDBj 5e-79 91.4 %
:RPS:PDB   15->102 2ec5A PDBj 3e-07 4.6 %
:RPS:SCOP  8->189 1b0pA4  c.64.1.1 * 3e-17 17.0 %
:HMM:SCOP  6->189 1b0pA4 c.64.1.1 * 6.5e-47 39.7 %
:RPS:PFM   17->185 PF01558 * POR 2e-20 40.9 %
:HMM:PFM   16->186 PF01558 * POR 1.1e-44 38.3 167/173  
:BLT:SWISS 1->192 PORC_THEMA e-107 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35109.1 GT:GENE AAD35109.1 GT:PRODUCT pyruvate ferredoxin oxidoreductase, gamma subunit GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 13245..13823 GB:FROM 13245 GB:TO 13823 GB:DIRECTION + GB:PRODUCT pyruvate ferredoxin oxidoreductase, gamma subunit GB:NOTE similar to PID:2052278 GB:AE000512 percent identity: 99.53; identified by sequence similarity; putative GB:PROTEIN_ID AAD35109.1 GB:DB_XREF GI:4980499 LENGTH 192 SQ:AASEQ MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSE GT:EXON 1|1-192:0| SW:ID PORC_THEMA SW:DE RecName: Full=Pyruvate synthase subunit porC; EC=1.2.7.1;AltName: Full=Pyruvate oxidoreductase gamma chain; Short=POR;AltName: Full=Pyruvic-ferredoxin oxidoreductase subunit gamma; SW:GN Name=porC; Synonyms=porG; OrderedLocusNames=TM_0015; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->192|PORC_THEMA|e-107|100.0|192/192| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 5->192|2raaA|5e-79|91.4|174/174| RP:PDB:NREP 1 RP:PDB:REP 15->102|2ec5A|3e-07|4.6|87/711| RP:PFM:NREP 1 RP:PFM:REP 17->185|PF01558|2e-20|40.9|164/178|POR| HM:PFM:NREP 1 HM:PFM:REP 16->186|PF01558|1.1e-44|38.3|167/173|POR| GO:PFM:NREP 2 GO:PFM GO:0016903|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors"|PF01558|IPR019752| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01558|IPR019752| RP:SCP:NREP 1 RP:SCP:REP 8->189|1b0pA4|3e-17|17.0|182/253|c.64.1.1| HM:SCP:REP 6->189|1b0pA4|6.5e-47|39.7|184/253|c.64.1.1|1/1|Pyruvate-ferredoxin oxidoreductase, PFOR, domain III| OP:NHOMO 213 OP:NHOMOORG 148 OP:PATTERN --2122212222222122233332-----1--21112211111322321111111111111-112--- ----------------------------------------1-1-------------------1----------------11--2212111112-11---------------------------------------------111--------------------------------------------111-----------------------------1------------------------------------------------------------------------------------------------------2-1--------------111----12-11--12---1-3122411-21---1--------------------1------------------------------------------------------------------1---------------------------------------------------------------------------1-------1----1----------------1-----111-----11-1111-11123------23-----------11111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------2212212111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 97.9 SQ:SECSTR ####ccEEEEEEEEccccEEEEEEEEccTTcEEEEEEEEEEEEccccEEEEEETTGGGccccccccccEEEEHHHHHHHHHHHTTEEEEcccccHHHHHTcccccHHHHHHHHccccEEEEEcHHHHHHHHTcccccHHHHHHHHHHHHccccHHHHHHHHHHcccTTccHHHHHHHHHHHHHHHHHcEEcc DISOP:02AL 1-3, 191-192| PSIPRED ccccccEEEEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEcccHHHcccEEEEEEEEccccEEcccccccccEEEEEcHHHHHHHHHcccccccEEEEcccccHHHHHHHHHcccEEEEEcHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccc //