[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35110.1
DDBJ      :             pyruvate ferredoxin oxidoreductase, delta subunit
Swiss-Prot:PORD_THEMA   RecName: Full=Pyruvate synthase subunit porD;AltName: Full=Pyruvate oxidoreductase delta chain;         Short=POR;AltName: Full=Pyruvic-ferredoxin oxidoreductase subunit delta;

Homologs  Archaea  54/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->87 1fcaA PDBj 1e-06 47.8 %
:RPS:PDB   37->100 1bluA PDBj 6e-08 26.6 %
:RPS:SCOP  18->100 2fug91  d.58.1.5 * 2e-09 28.9 %
:HMM:SCOP  28->99 2fug91 d.58.1.5 * 2.7e-20 31.9 %
:HMM:PFM   37->58 PF00037 * Fer4 2.5e-08 45.5 22/24  
:HMM:PFM   68->89 PF00037 * Fer4 3.9e-11 50.0 22/24  
:BLT:SWISS 3->101 PORD_THEMA 3e-60 100.0 %
:PROS 43->54|PS00198|4FE4S_FER_1
:PROS 73->84|PS00198|4FE4S_FER_1
:REPEAT 2|33->58|64->88

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35110.1 GT:GENE AAD35110.1 GT:PRODUCT pyruvate ferredoxin oxidoreductase, delta subunit GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 13830..14135 GB:FROM 13830 GB:TO 14135 GB:DIRECTION + GB:PRODUCT pyruvate ferredoxin oxidoreductase, delta subunit GB:NOTE similar to GP:1197392 percent identity: 100.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD35110.1 GB:DB_XREF GI:4980500 LENGTH 101 SQ:AASEQ MRMSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG GT:EXON 1|1-101:0| SW:ID PORD_THEMA SW:DE RecName: Full=Pyruvate synthase subunit porD;AltName: Full=Pyruvate oxidoreductase delta chain; Short=POR;AltName: Full=Pyruvic-ferredoxin oxidoreductase subunit delta; SW:GN Name=porD; OrderedLocusNames=TM_0016; SW:KW 4Fe-4S; Complete proteome; Direct protein sequencing;Electron transport; Iron; Iron-sulfur; Metal-binding; Repeat;Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 3->101|PORD_THEMA|3e-60|100.0|99/99| GO:SWS:NREP 5 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 43->54|PS00198|4FE4S_FER_1|PDOC00176| PROS 73->84|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|33->58|64->88| BL:PDB:NREP 1 BL:PDB:REP 41->87|1fcaA|1e-06|47.8|46/55| RP:PDB:NREP 1 RP:PDB:REP 37->100|1bluA|6e-08|26.6|64/80| HM:PFM:NREP 2 HM:PFM:REP 37->58|PF00037|2.5e-08|45.5|22/24|Fer4| HM:PFM:REP 68->89|PF00037|3.9e-11|50.0|22/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 18->100|2fug91|2e-09|28.9|83/154|d.58.1.5| HM:SCP:REP 28->99|2fug91|2.7e-20|31.9|72/0|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 171 OP:NHOMOORG 112 OP:PATTERN --2132313333333-22233332-----1--11111211111322221111112222222-112--- -------------------------------------------------------------------------------1--1--1-1-----------------------------------------------------111--------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------2----------------111----12--1---------21--3---21---1--------------------1------------------------------------------------------------------1---------------------------------------------------------------------------1-------1----1----------------1-----11-----------------12------22-----------11111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 86.1 SQ:SECSTR ##############cccccccGGGGTcccccccEEEEEEcTTcccccTTGGGcTTccEEEccccEEEcTTTTTccccHHHHHcTTccEEEcTTccccHHHE DISOP:02AL 95-101| PSIPRED ccccccccccccccccccccccccccccccEEEEEEEEcccccccccccHHHcccccEEEccccEEEEcccccccccccHHHcccccEEEEEccccccccc //