[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35115.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y021_THEMA   RecName: Full=UPF0166 protein TM_0021;

Homologs  Archaea  20/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->100 1o51A PDBj 3e-40 100.0 %
:RPS:PDB   2->99 2dclC PDBj 1e-22 42.7 %
:RPS:SCOP  2->100 1o51A  d.58.5.4 * 4e-23 97.7 %
:HMM:SCOP  1->100 1o51A_ d.58.5.4 * 3.4e-31 47.0 %
:RPS:PFM   2->98 PF02641 * DUF190 2e-25 53.6 %
:HMM:PFM   2->98 PF02641 * DUF190 2.8e-33 49.5 97/101  
:BLT:SWISS 1->102 Y021_THEMA 2e-56 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35115.1 GT:GENE AAD35115.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 17494..17802 GB:FROM 17494 GB:TO 17802 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000657 percent identity: 67.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD35115.1 GB:DB_XREF GI:4980505 LENGTH 102 SQ:AASEQ MKLLKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHKRHMHRSDFFSLSPDLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVVKMG GT:EXON 1|1-102:0| SW:ID Y021_THEMA SW:DE RecName: Full=UPF0166 protein TM_0021; SW:GN OrderedLocusNames=TM_0021; SW:KW 3D-structure; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->102|Y021_THEMA|2e-56|100.0|102/102| BL:PDB:NREP 1 BL:PDB:REP 2->100|1o51A|3e-40|100.0|84/86| RP:PDB:NREP 1 RP:PDB:REP 2->99|2dclC|1e-22|42.7|89/97| RP:PFM:NREP 1 RP:PFM:REP 2->98|PF02641|2e-25|53.6|97/101|DUF190| HM:PFM:NREP 1 HM:PFM:REP 2->98|PF02641|2.8e-33|49.5|97/101|DUF190| RP:SCP:NREP 1 RP:SCP:REP 2->100|1o51A|4e-23|97.7|86/89|d.58.5.4| HM:SCP:REP 1->100|1o51A_|3.4e-31|47.0|100/0|d.58.5.4|1/1|GlnB-like| OP:NHOMO 118 OP:NHOMOORG 108 OP:PATTERN -----------------------------------111111111---1-122--1111111------- --1-1-------------------------------------1-------------------1---1-1-------------11-111-------------------------------------11-111111111--22----1--------1-----------------------------1-11--------------------------------------------------------------------------------------------------------------------------------------------------------11------------1---------11----------2111-------1------1-211111111111-------------------------------------------------1------1---------------------------------1-----1-------------------------------------------------------------------11---11-11111-111111141-------------------------------1111---------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1-111-111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 90.2 SQ:SECSTR #EEEEEEEETTcEETTEEHHHHHHHHHHHHTccccEEEEccccccccc#########cTTccEEEEEEEEEHHHHHHHHHHHGGGccccEEEEEEEcccccc DISOP:02AL 102-103| PSIPRED ccEEEEEEccccccccEEHHHHHHHHHHHcccccHHHHHHHHccccccccccHHHEEccccccEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEEEEEEc //