[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35120.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->54 PF03899 * ATP_synt_I 0.00037 25.6 43/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35120.1 GT:GENE AAD35120.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(25549..25755) GB:FROM 25549 GB:TO 25755 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35120.1 GB:DB_XREF GI:4980510 LENGTH 68 SQ:AASEQ MFTKAVLSIFSWALVLELIVLFYYLWRGLRPVEFYLNLGLLGLTVPFLVFLVVREKKKRREEDDGKDR GT:EXON 1|1-68:0| TM:NTM 2 TM:REGION 4->26| TM:REGION 32->53| SEG 54->67|rekkkrreeddgkd| HM:PFM:NREP 1 HM:PFM:REP 10->54|PF03899|0.00037|25.6|43/100|ATP_synt_I| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 54-68| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //