[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35126.1
DDBJ      :             transcriptional regulator, XylR-related
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  308/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.55.1
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->326 1z05A PDBj 6e-18 24.3 %
:RPS:PDB   10->376 3bp8A PDBj 8e-36 16.9 %
:RPS:SCOP  10->68 1z05A1  a.4.5.63 * 2e-08 27.1 %
:RPS:SCOP  84->197 2gupA1  c.55.1.10 * 6e-13 21.7 %
:RPS:SCOP  209->381 2hoeA2  c.55.1.10 * 9e-27 34.0 %
:HMM:SCOP  8->78 1z05A1 a.4.5.63 * 6e-13 32.4 %
:HMM:SCOP  75->200 2hoeA3 c.55.1.10 * 3.9e-13 30.6 %
:HMM:SCOP  203->377 1z6rA3 c.55.1.10 * 1.3e-26 30.2 %
:RPS:PFM   18->67 PF01047 * MarR 1e-04 34.0 %
:RPS:PFM   99->243 PF00480 * ROK 6e-19 37.3 %
:RPS:PFM   244->298 PF09840 * DUF2067 4e-04 43.8 %
:HMM:PFM   107->244 PF00480 * ROK 5.3e-23 33.8 133/179  
:HMM:PFM   18->59 PF09339 * HTH_IclR 8.5e-08 40.5 42/52  
:BLT:SWISS 6->350 XYLR_ANATD 1e-19 26.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35126.1 GT:GENE AAD35126.1 GT:PRODUCT transcriptional regulator, XylR-related GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(31324..32469) GB:FROM 31324 GB:TO 32469 GB:DIRECTION - GB:PRODUCT transcriptional regulator, XylR-related GB:NOTE similar to PID:1208894 SP:Q44406 percent identity: 51.23; identified by sequence similarity; putative GB:PROTEIN_ID AAD35126.1 GB:DB_XREF GI:4980516 LENGTH 381 SQ:AASEQ MHKKLNPKSMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEKGTATGRRRKAVTYGPTRSFITSIIYNVEVLETLVAVGFLDGAWRIIERFSTPKDFDEFKQRVTSSYENILKSHVLNKNISKVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLEVLVENDSNLSLLAEEFFSQDVKESDVAFFLYFGEGIGGAISVNGKIVRGENFAAGEIGHVVLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRYIKRLWFSGEKNVKETMEEFLQHVAVVLKNIIYFLNPGVIVLGGVVNDLWDTFGSFIKRELEKITDREIANVLIRDTIFKEISPSLVGGNVLAIEEFLRQIT GT:EXON 1|1-381:0| BL:SWS:NREP 1 BL:SWS:REP 6->350|XYLR_ANATD|1e-19|26.7|329/399| BL:PDB:NREP 1 BL:PDB:REP 10->326|1z05A|6e-18|24.3|313/396| RP:PDB:NREP 1 RP:PDB:REP 10->376|3bp8A|8e-36|16.9|356/381| RP:PFM:NREP 3 RP:PFM:REP 18->67|PF01047|1e-04|34.0|50/59|MarR| RP:PFM:REP 99->243|PF00480|6e-19|37.3|142/181|ROK| RP:PFM:REP 244->298|PF09840|4e-04|43.8|48/190|DUF2067| HM:PFM:NREP 2 HM:PFM:REP 107->244|PF00480|5.3e-23|33.8|133/179|ROK| HM:PFM:REP 18->59|PF09339|8.5e-08|40.5|42/52|HTH_IclR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 3 RP:SCP:REP 10->68|1z05A1|2e-08|27.1|59/71|a.4.5.63| RP:SCP:REP 84->197|2gupA1|6e-13|21.7|106/114|c.55.1.10| RP:SCP:REP 209->381|2hoeA2|9e-27|34.0|156/168|c.55.1.10| HM:SCP:REP 8->78|1z05A1|6e-13|32.4|71/0|a.4.5.63|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 75->200|2hoeA3|3.9e-13|30.6|124/0|c.55.1.10|1/1|Actin-like ATPase domain| HM:SCP:REP 203->377|1z6rA3|1.3e-26|30.2|172/0|c.55.1.10|1/1|Actin-like ATPase domain| OP:NHOMO 526 OP:NHOMOORG 312 OP:PATTERN -------------------------------------------------------------111---- 111-41-----1-------------1-----------1-1-----11-2--12221-1-----211132122111244------1--------2-------------1-1--------------1------------1122---3----------------------11---------------1---54-2-122222222-22223215332-222211141-45545426-22111111122211--1--124----1--2----21111---122-------1--21123422122--11---------211---211-12-16-------3-32211-1111-21-112--------5-11644112--------------------------1111111-111----------1--7121331454-1--------1--1-----------1-----------------------------------------------1----1----------------------------------------------------------------------------------------11--------------------------1--11------------------------------1----------122211-1111111111-111111111111111111122211111111111111111111121111111--111111111111----------------------11--------1---------------------------------------22213333311222------------------------11-111-1--1----1-----1--------------124--45465--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 381 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHTTcEEEccccEEEccTTEEEcccccccEEEEEEEcccEEEEEEEETTccEEEEEEEEcccccccHHHHHHHHHHHHHHTTTTccEEEEEEEEEccEEETTTTEEEEccccccccccTTTHHHHTcccEEEEEHHHHHHHHHHHccTTHTTcccEEEEEEcccEEEEEEETTEEccccccccccGGGcccccccccccTTTccHHHHHHHHHTTTTTccccccccHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGHHHHHHHHHHHHHHHccHHHTTccEEEccccTHTcGGGGHHHHHHHHHHHHcc DISOP:02AL 1-10, 60-70| PSIPRED ccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccccccEEEEEEEcccEEEEEEEEEEEEEEEEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccEEEccccEEEEccccccccccHHHHHHHccccEEEEccHHHHHHHHHHHccccccccEEEEEEcccccEEEEEEccEEEEccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHHcccc //