[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35135.1
DDBJ      :             2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  750/915 : Eukaryota  115/199 : Viruses  0/175   --->[See Alignment]
d.58.30
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->112 1cbkA PDBj 4e-25 48.1 %
:RPS:PDB   5->118 1cbkA PDBj 1e-40 46.0 %
:RPS:SCOP  5->118 1cbkA  d.58.30.1 * 6e-41 46.0 %
:HMM:SCOP  5->129 1cbkA_ d.58.30.1 * 3.5e-45 58.4 %
:RPS:PFM   6->105 PF01288 * HPPK 1e-25 58.0 %
:HMM:PFM   3->105 PF01288 * HPPK 8.3e-41 57.3 103/127  
:HMM:PFM   97->125 PF09088 * MIF4G_like 0.00013 41.4 29/191  
:BLT:SWISS 1->118 FOL1_PNECA 9e-30 50.8 %
:PROS 62->73|PS00794|HPPK
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35135.1 GT:GENE AAD35135.1 GT:PRODUCT 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 40539..40928 GB:FROM 40539 GB:TO 40928 GB:DIRECTION + GB:PRODUCT 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine pyrophosphokinase GB:NOTE similar to GB:D26185 SP:P29252 PID:467468 GB:AL009126 percent identity: 65.87; identified by sequence similarity; putative GB:PROTEIN_ID AAD35135.1 GB:DB_XREF GI:4980526 LENGTH 129 SQ:AASEQ MNKRNIKVEKVSSVIETEPYGYEDQPRFLNAVCIAQTPLSPHELLNTLLQIERNMGRVRTIRWGPRIIDLDIVFYEDLVLSEEDLIIPHPDAHNRTFVLEPLCEIAPDLIHPVMGKTVRELLEDLRRRR GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 1->118|FOL1_PNECA|9e-30|50.8|118/740| PROS 62->73|PS00794|HPPK|PDOC00631| SEG 119->128|relledlrrr| BL:PDB:NREP 1 BL:PDB:REP 5->112|1cbkA|4e-25|48.1|108/160| RP:PDB:NREP 1 RP:PDB:REP 5->118|1cbkA|1e-40|46.0|113/160| RP:PFM:NREP 1 RP:PFM:REP 6->105|PF01288|1e-25|58.0|100/126|HPPK| HM:PFM:NREP 2 HM:PFM:REP 3->105|PF01288|8.3e-41|57.3|103/127|HPPK| HM:PFM:REP 97->125|PF09088|0.00013|41.4|29/191|MIF4G_like| GO:PFM:NREP 2 GO:PFM GO:0003848|"GO:2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity"|PF01288|IPR000550| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF01288|IPR000550| RP:SCP:NREP 1 RP:SCP:REP 5->118|1cbkA|6e-41|46.0|113/160|d.58.30.1| HM:SCP:REP 5->129|1cbkA_|3.5e-45|58.4|125/0|d.58.30.1|1/1|6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK| OP:NHOMO 936 OP:NHOMOORG 867 OP:PATTERN -------1---------1-------------------------------------------------- 111--1111111111111---1111111111111111111111111111111111111---11111-11111---111-11111111111111111----11-11111111111111111----111111111111---111111111111111111-11--121111-111--1111-111111-1111111111111111111111111111111111111111111111111111111111111-111111--1--11-1-1111--1--1--1111111111111111111111111111111111111111111111111-111111111-1-11111111--1-11--1-111111--111111111-111111-----111111111111111111111111-11111111111-111111111111111111--1111111111111111111111-1111111111-----------------------1-1111-1111111111111111111111111-11-1111--1--1-1-11--11111111111111111111-1111111111111111111111111-11111-11-11111111-11111111-111-11112221112112222112222112221211-12122------11111111111111111-1111111111111111111111111211111111111111111111111111111111111111111121111111112212111111111111111111111111111222122222122221-111--------1112222222111112211211222222212--111111-------------1----------------------11-1111111111 ----11------11111-11111-11111111111111111111--11111111111111111111111-1111111-1111111111-11111111111-11111-13-1-----------------------------------------------------------3----111161111111221211-11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 91.5 SQ:SECSTR HHHTTEEEEEEcccEEEccccccccccEEEEEEEEEEcccHHHHHHHHHHHHHHTTcccccTTcccccEEEEEEETTccEEccccEEccGGGGGcHHHHHHHHHHcTTcccTTTcccH########### DISOP:02AL 1-3, 127-129| PSIPRED ccccccEEEEEcccEEccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccEEEcccccEEccHHHHHcHHHHHHHHHHccccccccccHHHHHHHHHHHHcc //