[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35142.1
DDBJ      :             iron-sulfur cluster-binding protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   212->253 2fdnA PDBj 4e-07 47.6 %
:RPS:PDB   207->257 1durA PDBj 2e-08 33.3 %
:RPS:SCOP  207->254 1durA  d.58.1.1 * 2e-11 35.4 %
:HMM:SCOP  187->261 2fug91 d.58.1.5 * 3.6e-19 37.3 %
:RPS:PFM   2->153 PF04015 * DUF362 4e-31 44.6 %
:HMM:PFM   2->165 PF04015 * DUF362 1.7e-40 34.4 160/263  
:HMM:PFM   205->227 PF00037 * Fer4 1e-08 47.8 23/24  
:HMM:PFM   234->255 PF00037 * Fer4 3.9e-10 59.1 22/24  
:BLT:SWISS 2->206 Y1697_SYNY3 4e-30 35.6 %
:BLT:SWISS 187->254 Y749_METJA 6e-11 43.9 %
:PROS 212->223|PS00198|4FE4S_FER_1
:PROS 239->250|PS00198|4FE4S_FER_1
:REPEAT 2|202->227|229->254

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35142.1 GT:GENE AAD35142.1 GT:PRODUCT iron-sulfur cluster-binding protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 46296..47081 GB:FROM 46296 GB:TO 47081 GB:DIRECTION + GB:PRODUCT iron-sulfur cluster-binding protein GB:NOTE similar to GB:AE000666 percent identity: 56.54; identified by sequence similarity; putative GB:PROTEIN_ID AAD35142.1 GB:DB_XREF GI:4980533 LENGTH 261 SQ:AASEQ MRGCFSVTGVEDVCERLGVPCVPLDDPVEVSGEVFQKIKISRKVLEADKVVNLPKLKTHSQMVMTLGVKNTFGCVVGLEKSSWHMRAKNYDDFANLLIDIHRIVSPVLTILDGVEGMEGNGPTNGKKKHFGLVAVSKNAFALDDAVCKALGIDHVVYTVQHARKRRVVPDYEIVGTFHASIQLPSTVSTLDRLSRTFSRFFVKYPKIDTRKCVKCRLCEERCPASAIDISSQRIDYQKCIRCYVCHEVCPQDAIKLVRRLV GT:EXON 1|1-261:0| BL:SWS:NREP 2 BL:SWS:REP 2->206|Y1697_SYNY3|4e-30|35.6|205/321| BL:SWS:REP 187->254|Y749_METJA|6e-11|43.9|66/246| PROS 212->223|PS00198|4FE4S_FER_1|PDOC00176| PROS 239->250|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|202->227|229->254| BL:PDB:NREP 1 BL:PDB:REP 212->253|2fdnA|4e-07|47.6|42/55| RP:PDB:NREP 1 RP:PDB:REP 207->257|1durA|2e-08|33.3|51/55| RP:PFM:NREP 1 RP:PFM:REP 2->153|PF04015|4e-31|44.6|148/241|DUF362| HM:PFM:NREP 3 HM:PFM:REP 2->165|PF04015|1.7e-40|34.4|160/263|DUF362| HM:PFM:REP 205->227|PF00037|1e-08|47.8|23/24|Fer4| HM:PFM:REP 234->255|PF00037|3.9e-10|59.1|22/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 207->254|1durA|2e-11|35.4|48/55|d.58.1.1| HM:SCP:REP 187->261|2fug91|3.6e-19|37.3|75/0|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 114 OP:NHOMOORG 89 OP:PATTERN --------111111---------1----------1111------121--12221-------------- --2---------------------------------------------------------------------------------------1--1----------------------------------------------------11-211---11------11111111-----------------11-------------------------------------------------------------------------------------------------------------------------------------11---1111111-1--1--------1-----1-222---122----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------5-41111131111-111111211------21----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 43.3 SQ:SECSTR ##################################################################################################################################################cEcTTTccEEEccGGGGccccccccTcccccccccccccccccHHHHHHHHHHHHHEEEEEEcTTcccccccGGGcTTccEEccccEEcTTTcccccHHHHHcTTccEEEcTT## DISOP:02AL 260-262| PSIPRED cHHHHHHccHHHHHHHcccEEEcccccEEccHHHcccccccHHHHccccEEEccEEcccccEEEEEEEEccEEEEEccccHHHHHccccHHHHHHHHHHHHHHccccEEEEccEEEEcccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHcccccccEEEccccccccHHHccccccEEEccccccccccccccHHHHcccccEEEEccEEcHHHccccccHHHHcccccEEEEEEcc //