[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35143.1
DDBJ      :             transposase
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  95/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.57
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->104 2ec2F PDBj 8e-21 53.3 %
:RPS:PDB   29->104 2ec2A PDBj 1e-16 51.3 %
:RPS:SCOP  29->107 2a6mA1  d.58.57.1 * 2e-15 26.6 %
:HMM:SCOP  30->107 2a6oA1 d.58.57.1 * 5e-19 46.2 %
:RPS:PFM   30->102 PF01797 * Transposase_17 7e-12 39.7 %
:HMM:PFM   30->104 PF01797 * Transposase_17 1.6e-25 44.0 75/121  
:HMM:PFM   17->29 PF04434 * SWIM 0.00089 53.8 13/40  
:BLT:SWISS 30->104 T200_SALTY 2e-07 36.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35143.1 GT:GENE AAD35143.1 GT:PRODUCT transposase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(45992..46318) GB:FROM 45992 GB:TO 46318 GB:DIRECTION - GB:PRODUCT transposase GB:NOTE similar to PID:1054866 PID:2271024 percent identity: 69.88; identified by sequence similarity; putative GB:PROTEIN_ID AAD35143.1 GB:DB_XREF GI:4980534 LENGTH 108 SQ:AASEQ MTEKQPRKPFRFRGTGKRLACWSCSCYDWVLSLSIQPDHVHLFVSAPPRLAPAQIVNLFKGVSSKKLLEKFPHLRTREGLWSRTYYVGSVGTVSEETIRRYIEECQDM GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 30->104|T200_SALTY|2e-07|36.5|74/152| BL:PDB:NREP 1 BL:PDB:REP 30->104|2ec2F|8e-21|53.3|75/129| RP:PDB:NREP 1 RP:PDB:REP 29->104|2ec2A|1e-16|51.3|76/130| RP:PFM:NREP 1 RP:PFM:REP 30->102|PF01797|7e-12|39.7|73/119|Transposase_17| HM:PFM:NREP 2 HM:PFM:REP 30->104|PF01797|1.6e-25|44.0|75/121|Transposase_17| HM:PFM:REP 17->29|PF04434|0.00089|53.8|13/40|SWIM| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01797|IPR002686| GO:PFM GO:0004803|"GO:transposase activity"|PF01797|IPR002686| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01797|IPR002686| RP:SCP:NREP 1 RP:SCP:REP 29->107|2a6mA1|2e-15|26.6|79/130|d.58.57.1| HM:SCP:REP 30->107|2a6oA1|5e-19|46.2|78/0|d.58.57.1|1/1|Transposase IS200-like| OP:NHOMO 320 OP:NHOMOORG 114 OP:PATTERN --1---1--111--17--------13311-62--------------------3-------1-12---- ---------------------2----------1------1--34----------------------1---2----------1--------------------------2---------------------------9----------14-3-13-----------9--3---------------11-------------5------112--------------1-------2----------------------------5--1--FF---1-----------1------------------------------44---222-1---------1--1-71-------2--1-1--31-111--21----1--3-----------------1--------------------------------------------------1------------------------------------------------------------------------------------------------------1---------------------------1-------1-----------------------------------------------------------18-2-----23--------9--12-----------------211----1--1---1--1-12-1------------8C---1-------1-11----1------------------------------------------------24-------------------------------------------P47447---------------------1------------------------------------------------3-3-2--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 73.1 SQ:SECSTR ############################EEEEEEEETTEEEEEEEccTTccHHHHHHHHHHHHHHHHHHTTHHHHHTccccccccEEEEEccccHHHHHHHHHHccc# DISOP:02AL 106-108| PSIPRED cccccccHHHcHHHHHHHHHHHHHHHccEEEEEEEcccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcHHcccccccccccEEEEEcccccHHHHHHHHHHHHcc //