[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35163.1
DDBJ      :             D-mannonate hydrolase
Swiss-Prot:UXUA_THEMA   RecName: Full=Mannonate dehydratase;         EC=4.2.1.8;AltName: Full=D-mannonate hydrolase;

Homologs  Archaea  6/68 : Bacteria  213/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.1.15
:360 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->351 3banA PDBj e-102 55.0 %
:RPS:PDB   1->358 3banB PDBj 7e-40 52.1 %
:RPS:SCOP  2->353 1tz9A  c.1.15.6 * e-157 54.8 %
:HMM:SCOP  1->356 1tz9A_ c.1.15.6 * 6.3e-98 38.8 %
:RPS:PFM   1->354 PF03786 * UxuA e-104 55.1 %
:HMM:PFM   1->354 PF03786 * UxuA 1e-171 61.9 349/351  
:BLT:SWISS 1->360 UXUA_THEMA 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35163.1 GT:GENE AAD35163.1 GT:PRODUCT D-mannonate hydrolase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 69945..71027 GB:FROM 69945 GB:TO 71027 GB:DIRECTION + GB:PRODUCT D-mannonate hydrolase GB:NOTE similar to PID:1143601 SP:Q60040 percent identity: 99.44; identified by sequence similarity; putative GB:PROTEIN_ID AAD35163.1 GB:DB_XREF GI:4980556 LENGTH 360 SQ:AASEQ MKLVFRWYGEKHDTVTLEQIRQIPGVEGVVGALFDIPVGEVWPFEEIMKLKETVEKAGLKLEVIESVNVHEDIKLGLPTRDRYIENYKKTIRNLAKAGVKVVCYNFMPVFDWMRTDLHKKLPDGSETMEYDHRLIEGVTPDELIKRVKEGSQGFVLPGWEWDRLEKLRETFELYKNVDEEKLFENLVYFLERVIPVCEECDVKLAIHPDDPPWSIFGLPRIITNKENIERMLKAVDSPYNGITFCMGSLGANPENNIPEMIRYFGKMGRIHFAHVRNLKFTGEKSFYETAHPSFCGSHDLFEVMKAFHDIGYEGYIRPDHGRLIWGEKARPGYGLYDRALGATYILGLWEAIDKMKKRYC GT:EXON 1|1-360:0| SW:ID UXUA_THEMA SW:DE RecName: Full=Mannonate dehydratase; EC=4.2.1.8;AltName: Full=D-mannonate hydrolase; SW:GN Name=uxuA; OrderedLocusNames=TM_0069; SW:KW Complete proteome; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->360|UXUA_THEMA|0.0|100.0|360/360| GO:SWS:NREP 1 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 1->351|3banA|e-102|55.0|327/349| RP:PDB:NREP 1 RP:PDB:REP 1->358|3banB|7e-40|52.1|330/349| RP:PFM:NREP 1 RP:PFM:REP 1->354|PF03786|e-104|55.1|345/347|UxuA| HM:PFM:NREP 1 HM:PFM:REP 1->354|PF03786|1e-171|61.9|349/351|UxuA| GO:PFM:NREP 2 GO:PFM GO:0006064|"GO:glucuronate catabolic process"|PF03786|IPR004628| GO:PFM GO:0008927|"GO:mannonate dehydratase activity"|PF03786|IPR004628| RP:SCP:NREP 1 RP:SCP:REP 2->353|1tz9A|e-157|54.8|341/344|c.1.15.6| HM:SCP:REP 1->356|1tz9A_|6.3e-98|38.8|353/0|c.1.15.6|1/1|Xylose isomerase-like| OP:NHOMO 265 OP:NHOMOORG 222 OP:PATTERN -----------------2-----------11------------------------------111---- --3------------------------------------------1-----------------1------------------------112311-----1-2--12-4-2-----------------------------------1-------------------------------------1-------1-1---------------2222-1-----1-1---------2------------------1-1-1------------11------1111111111---------1-----------1------11---111112-13----------2----1--1--1--1------------1---1-----------------111--------11111111111------1--21--3332222222111------11111111--------1------------------------------------------------1111------111-------1--1----------------1-----------------------------------------------------1-------------------------------1--2--1-1--------------------------------211111-1111111111-11-11111111111111112221111-1111111111111111111-11111-111111111111----------------11---2-1-1111-11------------1------------------------------1------1-11-----------------1-----------------------------------------------1-111-1- ------1-----------------------------------------------------------------------------------------------------2-----------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 358 STR:RPRED 99.4 SQ:SECSTR EEEEEEcccTTTccccHHHHHTcTTccEEEEccccccTTccccHHHHHHHHHHHHHTTcEEEEEEcccccHHHHHTcTTHHHHHHHHHHHHHHHHHHTccEEEEcccccccccccccccccTTcccEEEEEHHHHcccccccEEccccccccccccHHHHHHHEcccccEEccHHTccHHHHHHHHHHHHHHHHHHHHHTTcEEEEcccccccccTTcccccccHHHHHHHHHTcccTTEEEEEEHHHHTTcTTccHHHHHHHHHHTTcEEEEEccEEEEEETTEEEEEcccGGGccccHHHHHHHHHHTTcEEEEEccccccTTcccccGGGcHHHHHHHHHHHHHHHHHHHHHTTc## PSIPRED ccccEEEEccccccccHHHHHHcccccHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHccccHHHHHHHHHHHHHHHHHHcccEEEEccccHHcHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHHHcccEEEEEEEEEEEcccccEEEcccccccccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc //