[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35172.1
DDBJ      :             iron(III) ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  910/915 : Eukaryota  198/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:256 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->226 2it1B PDBj 3e-28 34.1 %
:RPS:PDB   3->229 3b5jA PDBj 1e-41 27.1 %
:RPS:SCOP  3->245 1b0uA  c.37.1.12 * 3e-39 24.7 %
:HMM:SCOP  4->225 1pf4A1 c.37.1.12 * 1.4e-57 37.0 %
:RPS:PFM   43->168 PF00005 * ABC_tran 3e-12 35.0 %
:HMM:PFM   43->168 PF00005 * ABC_tran 7.4e-16 27.6 116/118  
:HMM:PFM   140->213 PF02463 * SMC_N 6.4e-07 30.1 73/220  
:HMM:PFM   22->56 PF00437 * GSPII_E 9e-05 31.4 35/282  
:BLT:SWISS 4->256 YVRA_BACSU 9e-39 34.8 %
:PROS 140->154|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35172.1 GT:GENE AAD35172.1 GT:PRODUCT iron(III) ABC transporter, ATP-binding protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(81441..82211) GB:FROM 81441 GB:TO 82211 GB:DIRECTION - GB:PRODUCT iron(III) ABC transporter, ATP-binding protein GB:NOTE similar to GB:AE000782 percent identity: 63.27; identified by sequence similarity; putative GB:PROTEIN_ID AAD35172.1 GB:DB_XREF GI:4980566 LENGTH 256 SQ:AASEQ MEIVRIENLFFQYRGGFSLKNINLSVKKGEFFGIIGPNGSGKTTLLKILVGIFRPQKGTVQLLGRIPWETSRKEMAKIVTLVSQDFFPSYDFSVKEIVEMGRLPHLSLLSGTSRKDEEIVLKSLELTGTLKFVDRNFWTLSSGERRKVVLSKAIVQDTEILLIDELTAHLDYNNVSLVGNVLKRLKESGKTIISVFHDINVASALCDRIGVMKNGEMIKTGAPPEVVTEEVLRNTFETEFVVLEHPVTGRPLAFLK GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 4->256|YVRA_BACSU|9e-39|34.8|253/442| PROS 140->154|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 4->226|2it1B|3e-28|34.1|217/361| RP:PDB:NREP 1 RP:PDB:REP 3->229|3b5jA|1e-41|27.1|225/243| RP:PFM:NREP 1 RP:PFM:REP 43->168|PF00005|3e-12|35.0|120/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 43->168|PF00005|7.4e-16|27.6|116/118|ABC_tran| HM:PFM:REP 140->213|PF02463|6.4e-07|30.1|73/220|SMC_N| HM:PFM:REP 22->56|PF00437|9e-05|31.4|35/282|GSPII_E| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->245|1b0uA|3e-39|24.7|243/258|c.37.1.12| HM:SCP:REP 4->225|1pf4A1|1.4e-57|37.0|219/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 46355 OP:NHOMOORG 1176 OP:PATTERN UUKCTMKMZZaWZVYRjIOQKQJYmNRdcXaMIBFFFBHGGGETbRVlMS**i7UjUXdPTNLGZ25A QWsK*dbfkkmVZQRLOLL-LdAAS*LLLLLLklkno***Q*Q*k*ralgcL**zOPgFGrusk*ly***YVSSS*YXcQ*diBACACUUTN5PFHJ11FIVKPMdOZIV6A9999ABBCAAAAJRQHSXIMVSbTfnmxyKJH*YpflzgggWcQQLFHGNDdYYf***bLJHLKLKMIOHLbYYPKqj9ah*************************jqx**lqz**xxx**clmnmnjikkmmlkjcgaec*gaczydQgXjrpNO**aWRXlhilmqpuxpnvyz*qusqnotvppteeeddefgifede*opedgrpspp*y*********m*mt***bjih*xjx*zjpSI**uhXchjSWmflnOggUNbOMMHIJJJLYM***TNp****t***********-bf*aT*cy**ND**************HGJ**********QPQQQQQQiRWHNdUw76568666546776BB6797777788695HA5D9Ey**t*******upnpl****xquud****zy*uBMppcxYidi*v****TfeIUIMeSHHIIJHIOKPXoYY**PgSngXXtZaeFbcaRRThPWQQPOjoYxMNPRHLLMMKG8BCBAABBCGSFHJIHkluMpUcIVLvNTWXUPVaTRTWRTaXZWZ6-BJPOK321222*p**U*vtzzwuxxyqr-xsssyswsvtyywoqsqps*****kmhnojklmmnnlkknkkk*mhkooopQ4z***********43IGFJFFGMMPORG*i*XWWYZVHORNMTPUcMOQOOGODIVibqsqqq***nz*qqe***ECDBDDEDCLdlk*pqqqqx**zxOMLJKJKIJKCCBCA7KSRRMMMN9A8AA9AA*EaDAA9A-C9D9EB9NMI9DHBFC99AbowTUo*npmDYO 1255eYF1WI6GUdVFDCCDJNINGPLGG9B9BLMJCGBCAEECA9DDGINKPKBAI8BHDGF6D88B4997ACC7A39C8A98796A-NL7DGDF988BA5ENGH5MNbsVXTkddJJGDGYMso8zA**q4tXtLHJAlBJiRBMFBBb8B*GaQUtIi*KnRd8*Xl*daXRFHHG*DGDBHmbj*E*aDGiXffF ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 256-257| PSIPRED ccEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHHccHHHHHHHHcEEcccccccccccHHHHHHHcccccHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHcccEEEEEEcccccEEEEEEc //