[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35174.1
DDBJ      :             iron(III) ABC transporter, periplasmic-binding protein, putative
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  409/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->265 1n2zA PDBj 8e-19 33.2 %
:RPS:PDB   56->310 3eiwA PDBj 3e-43 18.1 %
:RPS:SCOP  56->310 2phzA1  c.92.2.4 * 1e-41 18.8 %
:HMM:SCOP  42->328 2chuA1 c.92.2.4 * 6e-58 34.3 %
:RPS:PFM   71->301 PF01497 * Peripla_BP_2 3e-25 34.5 %
:HMM:PFM   71->303 PF01497 * Peripla_BP_2 3.4e-39 28.4 225/238  
:BLT:SWISS 56->310 YVRC_BACSU 6e-30 34.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35174.1 GT:GENE AAD35174.1 GT:PRODUCT iron(III) ABC transporter, periplasmic-binding protein, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(83178..84167) GB:FROM 83178 GB:TO 84167 GB:DIRECTION - GB:PRODUCT iron(III) ABC transporter, periplasmic-binding protein, putative GB:NOTE similar to GB:AL009126 percent identity: 56.83; identified by sequence similarity; putative GB:PROTEIN_ID AAD35174.1 GB:DB_XREF GI:4980568 LENGTH 329 SQ:AASEQ MIRKPGNPPAVKGNHLPRHQEGGNILFQGGMEVFRKLVSLILLFVTAVALAVTVVDNAGRVVEITSAPERVVSLSPAATRFLVFLGLEDKIVGVTDYDSYEAEKVGAMVPVNIEKVVSLNPDLVLMFGGFQLPEVPKLEKAGLKVLVVNPNSLNDIIRDVVLLGTIFDRRDLALEKSEKLREKMLEIGKKTYNVPPSKRPKVLYLISSPGPDVKEIWTCGMGSYLNEIISLAGGVNIASGIAGPNGWPQLSIEYVVSQNPDVIIVGVYIPGTENEEIKKILNFEPFKEINAVKNKRVFAVDGNVASQPSPDVFELLDLFYEFFYGGKGE GT:EXON 1|1-329:0| BL:SWS:NREP 1 BL:SWS:REP 56->310|YVRC_BACSU|6e-30|34.9|241/314| TM:NTM 1 TM:REGION 37->59| SEG 42->55|llfvtavalavtvv| SEG 313->324|felldlfyeffy| BL:PDB:NREP 1 BL:PDB:REP 67->265|1n2zA|8e-19|33.2|187/245| RP:PDB:NREP 1 RP:PDB:REP 56->310|3eiwA|3e-43|18.1|248/292| RP:PFM:NREP 1 RP:PFM:REP 71->301|PF01497|3e-25|34.5|220/235|Peripla_BP_2| HM:PFM:NREP 1 HM:PFM:REP 71->303|PF01497|3.4e-39|28.4|225/238|Peripla_BP_2| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 56->310|2phzA1|1e-41|18.8|245/277|c.92.2.4| HM:SCP:REP 42->328|2chuA1|6e-58|34.3|277/0|c.92.2.4|1/1|"Helical backbone" metal receptor| OP:NHOMO 719 OP:NHOMOORG 451 OP:PATTERN 221-1111-------2-1---22-1111-111---1--1-1-111534B198--1111231312---- -1-----1222--------------------------1----1-----1-1---------11-2212-121--------1-11------------------211-1111-----------------111211---1111-12132--------1-------------111-------------2431111-12211111122-2211123422312222225---22232243133333333333333111321------1----------------------11-1--------------------------1----------161222232332221-221221121--31--3312--81112322-14-22-----121-1--1----1112-1-------------------1-1--2--2---111--------11----11------------1--------------------------------------------------11111--1-1111111--1111--111121--322211111-111-1---------1112-3312111-1111-----1---12--1-2-151152-1111-----------11-----1111111-1111111111211111121132---1--1------212--2-1224133211-211122212122211111111124221212112222222221221-21111--111111111111--------------1--3----1---------1--11-11--1-111111222-----1------------111111111111211-----------------1111111--------2---------------------------1121113121--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 78.1 SQ:SECSTR #######################################################EETTEEEEEETTcccEEEccHHHHHHHHHTTccccEEccTTcGGGccEEccccccccHHHHHHTcccEEEEETTTTTTTHHHHHHHccEEEEccTccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHccTccccTTccEEEEEEETTEETTEEEEccTTcHHHHHHHHTTccccccHHHHHTTEEEEcHHHHHHHcccEEEEEEGGGccccHHHHHHHHcHHHHTcHHHHTTcEEEEEHHHHTTTccTH################# DISOP:02AL 1-7| PSIPRED cccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccEEEEcccccEEEEEccHHHHHHHHHcccccEEEEEcccccccHHccccccccHHHHHHccccEEEEEccccHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccEEEEcccccHHHHHHHHHcccccHHHcccccccccccHHHHHHHcccEEEEEcccccccHHHHHHHHHccHHHcccHHHccEEEEEccHHHHccccHHHHHHHHHHHHHcccccc //