[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35175.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:FLIW_THEMA   RecName: Full=Flagellar assembly factor fliW;

Homologs  Archaea  0/68 : Bacteria  107/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.158.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->141 2aj7B PDBj 8e-13 28.3 %
:RPS:PDB   2->145 2aj7A PDBj 1e-38 26.8 %
:RPS:SCOP  2->141 2aj7A1  b.158.1.1 * 2e-38 27.3 %
:HMM:SCOP  2->147 2aj7A1 b.158.1.1 * 7.9e-42 42.1 %
:RPS:PFM   19->136 PF02623 * FliW 1e-18 44.4 %
:HMM:PFM   18->138 PF02623 * FliW 5.2e-41 42.5 120/121  
:BLT:SWISS 1->149 FLIW_THEMA 3e-83 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35175.1 GT:GENE AAD35175.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(84320..84769) GB:FROM 84320 GB:TO 84769 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000783 percent identity: 58.02; identified by sequence similarity; putative GB:PROTEIN_ID AAD35175.1 GB:DB_XREF GI:4980570 LENGTH 149 SQ:AASEQ MVYKTKLGEIEISDESIFTFEKGIPGFEHLRKFALVFPQETFPIGWLLSLEDSEVGLPVVDPKLVRADYDPAVPSEDLEEIEAENQEALLFFCVLTIPPGKPEKTTINLRAPIILNQKKKKGIQTILENEDYQLRHLLSEEIERSKTVV GT:EXON 1|1-149:0| SW:ID FLIW_THEMA SW:DE RecName: Full=Flagellar assembly factor fliW; SW:GN Name=fliW; OrderedLocusNames=TM_0081; SW:KW Bacterial flagellum biogenesis; Complete proteome; Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|FLIW_THEMA|3e-83|100.0|149/149| GO:SWS:NREP 2 GO:SWS GO:0043064|"GO:flagellum organization"|Bacterial flagellum biogenesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| BL:PDB:NREP 1 BL:PDB:REP 2->141|2aj7B|8e-13|28.3|138/146| RP:PDB:NREP 1 RP:PDB:REP 2->145|2aj7A|1e-38|26.8|142/155| RP:PFM:NREP 1 RP:PFM:REP 19->136|PF02623|1e-18|44.4|117/121|FliW| HM:PFM:NREP 1 HM:PFM:REP 18->138|PF02623|5.2e-41|42.5|120/121|FliW| GO:PFM:NREP 2 GO:PFM GO:0009296|"GO:flagellum assembly"|PF02623|IPR003775| GO:PFM GO:0019861|"GO:flagellum"|PF02623|IPR003775| RP:SCP:NREP 1 RP:SCP:REP 2->141|2aj7A1|2e-38|27.3|139/148|b.158.1.1| HM:SCP:REP 2->147|2aj7A1|7.9e-42|42.1|145/0|b.158.1.1|1/1|BH3618-like| OP:NHOMO 108 OP:NHOMOORG 107 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111111---1111111------11------------------------------------------------------------------------------------------11111111111111111111---111--1111-111111-1111111----11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11111-2-111111111----1111-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111--------------------------1-11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 96.6 SQ:SECSTR #EEEETTEEEEEEGGGEEEcTTccTTcTTccEEEEEEccTTccEEEEEEcccTTcEEEEEcGGGTcTTccccccHHHHHHTTcccGGGEEEEEEEEcccccGGGcEEcccccEEEETTTTTEEEcccccccccTTEEcccccccc#### DISOP:02AL 145-149| PSIPRED cEEEEEEcEEEEcHHHEEEccccccccHHcccEEEEEcccccEEEEEEEcccccEEEEEEcHHHHcccccEEccHHHHHHHccccHHcEEEEEEEEEccccHHHHHHHHcccEEEEcccccEEEEEEccccccccccHHHHHHHccccc //