[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35178.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.47.5
:116 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->109 2fupA1 a.47.5.1 * 2.6e-06 27.8 %
:HMM:PFM   1->106 PF05130 * FlgN 8.5e-13 36.4 99/143  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35178.1 GT:GENE AAD35178.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(88368..88718) GB:FROM 88368 GB:TO 88718 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35178.1 GB:DB_XREF GI:4980573 LENGTH 116 SQ:AASEQ MREELKRVLTEKIRLMENMRNLLEEELEAIINKDFERLESILPRIEELSVSMETCNERLKSSLESHGNGTKLIDLLEIYKDDEEMLSELRSFFETLNKLVFEIEKLKQAIGFHLNS GT:EXON 1|1-116:0| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 3->30| SEG 14->28|rlmenmrnlleeele| HM:PFM:NREP 1 HM:PFM:REP 1->106|PF05130|8.5e-13|36.4|99/143|FlgN| HM:SCP:REP 1->109|2fupA1|2.6e-06|27.8|108/0|a.47.5.1|1/1|FlgN-like| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 59-66| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //