[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35186.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->26 PF12196 * hNIFK_binding 0.00025 50.0 18/41  
:HMM:PFM   100->157 PF07998 * Peptidase_M54 0.0007 19.3 57/194  
:HMM:PFM   151->183 PF07375 * Tenui_PV2 0.00091 33.3 33/191  
:HMM:PFM   80->116 PF02955 * GSH-S_ATP 0.00089 32.4 37/176  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35186.1 GT:GENE AAD35186.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(96548..97441) GB:FROM 96548 GB:TO 97441 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35186.1 GB:DB_XREF GI:4980581 LENGTH 297 SQ:AASEQ MKLLDHKLSLLEITDEEKSDEIILNLSRNVKKDLEDIVVANVSMENVLVMNIKVPPTLNKQNAVEYATMEISRNLGILPEQLVVAPLDIRGGEGLFFVSKVDQVKSFVTDLMKKEFPETDVVIPDIVKYLEVFEFYFGKRLKGTSVLTVISFLSDYYSIVVLENNHYRSLRLLFSMFWDYMDIVVENTGIQPKELIEGTVNVDLSFLQPYFGDFLIELDREVKVSLDEVNLSRVNQFFYIVDPPIFSPVLSQSLEKFEGVALKQGIVPSFKPGISLGTLGLMIRGGREIGKVKHLSV GT:EXON 1|1-297:0| HM:PFM:NREP 4 HM:PFM:REP 9->26|PF12196|0.00025|50.0|18/41|hNIFK_binding| HM:PFM:REP 100->157|PF07998|0.0007|19.3|57/194|Peptidase_M54| HM:PFM:REP 151->183|PF07375|0.00091|33.3|33/191|Tenui_PV2| HM:PFM:REP 80->116|PF02955|0.00089|32.4|37/176|GSH-S_ATP| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHcccEEEEEcccccccEEEEEEcHHHHHHHHHHEEEccccccEEEEEEEccccccccccHHHHHEEHHcccccccHHHEEEEEEEcccccEEEHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccccHHHHHccHHcEEHHHHHHHHHHHHEEEcccEEEEHHHccHHHHcEEEEEEcccHHHHHHHHHHHHHcccHHHcccccccccccccHHHHEEEEccHHHccEEcccc //