[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35208.1
DDBJ      :             sugar ABC transporter, periplasmic sugar-binding protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  368/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:335 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->335 2h3hB PDBj e-164 100.0 %
:RPS:PDB   33->335 3c6qB PDBj 2e-49 94.7 %
:RPS:SCOP  33->322 1tjyA  c.93.1.1 * 9e-40 23.9 %
:HMM:SCOP  31->322 2fvyA1 c.93.1.1 * 7.5e-72 41.1 %
:RPS:PFM   33->217 PF00532 * Peripla_BP_1 3e-19 34.6 %
:HMM:PFM   34->237 PF00532 * Peripla_BP_1 2.1e-20 24.4 197/279  
:BLT:SWISS 37->275 RBSB_BACSU 7e-20 27.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35208.1 GT:GENE AAD35208.1 GT:PRODUCT sugar ABC transporter, periplasmic sugar-binding protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 119869..120876 GB:FROM 119869 GB:TO 120876 GB:DIRECTION + GB:PRODUCT sugar ABC transporter, periplasmic sugar-binding protein GB:NOTE similar to SP:P36949 GB:Z25798 PID:397499 PID:1894757 GB:AL009126 percent identity: 51.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD35208.1 GB:DB_XREF GI:4980605 LENGTH 335 SQ:AASEQ MWNKTSLQGGVIMRKLLVFLSVLLVAGLSLALTIGVIGKSVHPYWSQVEQGVKAAGKALGVDTKFFVPQKEDINAQLQMLESFIAEGVNGIAIAPSDPTAVIPTIKKALEMGIPVVTLDTDSPDSGRYVYIGTDNYQAGYTAGLIMKELLGGKGKVVIGTGSLTAMNSLQRIQGFKDAIKDSEIEIVDILNDEEDGARAVSLAEAALNAHPDLDAFFGVYAYNGPAQALVVKNAGKVGKVKIVCFDTTPDILQYVKEGVIQATMGQRPYMMGYLSVTVLYLMNKIGVQNTLMMLPKVKVDGKVDYVIDTGVDVVTPENLDEYLKKMEELGIPIKF GT:EXON 1|1-335:0| BL:SWS:NREP 1 BL:SWS:REP 37->275|RBSB_BACSU|7e-20|27.4|234/305| TM:NTM 1 TM:REGION 16->38| SEG 16->32|llvflsvllvaglslal| SEG 230->243|vvknagkvgkvkiv| BL:PDB:NREP 1 BL:PDB:REP 33->335|2h3hB|e-164|100.0|303/305| RP:PDB:NREP 1 RP:PDB:REP 33->335|3c6qB|2e-49|94.7|303/305| RP:PFM:NREP 1 RP:PFM:REP 33->217|PF00532|3e-19|34.6|179/261|Peripla_BP_1| HM:PFM:NREP 1 HM:PFM:REP 34->237|PF00532|2.1e-20|24.4|197/279|Peripla_BP_1| RP:SCP:NREP 1 RP:SCP:REP 33->322|1tjyA|9e-40|23.9|289/316|c.93.1.1| HM:SCP:REP 31->322|2fvyA1|7.5e-72|41.1|275/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 1115 OP:NHOMOORG 374 OP:PATTERN -------11-1--1--1--------------------------------------------------- -31141--2221---------111-4------1----1431--111---2--121--------1415651------------8-----1112-2------1------5-1--------------------------1--22---1111------------------11-1-------------11---44-32122222122123222315222122-144--11------18------------------11-1--11----1-----1------11111111-1------------------------------------111-24-----1--1-12--1--17121-1--1----1-151-231311----4---------4-879--------111-111-11B---------2H--EDD7BADDFBIG21---344424422---------7661---3----------------------------------------4443344111122ED43332431A-2----2213-2--11224G-------22-----------------------2------------------81----------------------------123--1----3---11-122111111-11--------------42343424444454544-4445435464454554555989331212122222222222222411----11-588888878888-----------1---2-6111211-11212353----------4-1111121311111-222----------11121111111122-------------------------------------------------------------121-23142-2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 303 STR:RPRED 90.4 SQ:SECSTR ################################EEEEEcccccTHHHHHHHHHHHHHHHHTcEEEEEccccccHHHHHHHHHHHHHHTccEEEEccccTTTTHHHHHHHHHTTccEEEEccccTTccccEEEEccHHHHHHHHHHHHHHHHTTccEEEEEEcccccHHHHHHHHHHHHHHTTcccEEEEEEEccccHHHHHHHHHHHHHHcTTccEEEEccTTHHHHHHHHHHHTTccTTcEEEEEcccHHHHHHHHTTcccEEEEEcHHHHHHHHHHHHHHHHHTcHHHHHTTccEEEETTEEEEEEEccEEEEcTTTHHHHHHHHHHTTccccc DISOP:02AL 1-7| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccccEEEEEccccccccEEEEEccHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHccccccHHHHccccccccccccEEccccEEEcHHHHHHHHHHHHHcccEEcc //