[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35220.1
DDBJ      :             response regulator
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  859/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->217 1p2fA PDBj e-118 100.0 %
:RPS:PDB   2->213 3c3wB PDBj 7e-31 23.4 %
:RPS:SCOP  3->120 1p2fA2  c.23.1.1 * 1e-40 98.3 %
:RPS:SCOP  121->217 1p2fA1  a.4.6.1 * 6e-26 99.0 %
:HMM:SCOP  1->120 1p2fA2 c.23.1.1 * 4.2e-29 39.5 %
:HMM:SCOP  121->217 1p2fA1 a.4.6.1 * 5.7e-28 44.3 %
:RPS:PFM   5->112 PF00072 * Response_reg 2e-15 44.3 %
:RPS:PFM   141->213 PF00486 * Trans_reg_C 2e-12 45.2 %
:HMM:PFM   141->215 PF00486 * Trans_reg_C 4.7e-27 50.7 75/77  
:HMM:PFM   5->112 PF00072 * Response_reg 4e-23 31.5 108/112  
:BLT:SWISS 4->213 PHOP_BACSU 7e-35 40.0 %
:PROS 87->112|PS00217|SUGAR_TRANSPORT_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35220.1 GT:GENE AAD35220.1 GT:PRODUCT response regulator GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 132801..133463 GB:FROM 132801 GB:TO 133463 GB:DIRECTION + GB:PRODUCT response regulator GB:NOTE similar to GB:M16775 SP:P13792 GB:X67676 PID:143328 PID:143330 percent identity: 60.09; identified by sequence similarity; putative GB:PROTEIN_ID AAD35220.1 GB:DB_XREF GI:4980618 LENGTH 220 SQ:AASEQ MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTGGER GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 4->213|PHOP_BACSU|7e-35|40.0|210/240| PROS 87->112|PS00217|SUGAR_TRANSPORT_2|PDOC00190| BL:PDB:NREP 1 BL:PDB:REP 3->217|1p2fA|e-118|100.0|212/212| RP:PDB:NREP 1 RP:PDB:REP 2->213|3c3wB|7e-31|23.4|201/210| RP:PFM:NREP 2 RP:PFM:REP 5->112|PF00072|2e-15|44.3|106/111|Response_reg| RP:PFM:REP 141->213|PF00486|2e-12|45.2|73/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 141->215|PF00486|4.7e-27|50.7|75/77|Trans_reg_C| HM:PFM:REP 5->112|PF00072|4e-23|31.5|108/112|Response_reg| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 3->120|1p2fA2|1e-40|98.3|118/120|c.23.1.1| RP:SCP:REP 121->217|1p2fA1|6e-26|99.0|97/97|a.4.6.1| HM:SCP:REP 1->120|1p2fA2|4.2e-29|39.5|119/0|c.23.1.1|1/1|CheY-like| HM:SCP:REP 121->217|1p2fA1|5.7e-28|44.3|97/0|a.4.6.1|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 10378 OP:NHOMOORG 881 OP:PATTERN -----------------------------1-----1-------11-16-3211----1---------- 7LI7N366778555ABB99-9F33AB999998HDFFAFGE8BBD79676896BBE45711KHK6M7GNLL7444465548HC724477FFXO-F22---45F498R5K9I1---------1111242322226261NKKPOJAER6ULVRON9DFAB755778EJBDYYeD684565675545DC777452A6GVVWVWTTWHWSXXURGKFDBDVWc8BCT8EDA99A9BgZ8BBABAA9AABBBAA7AAA7C675CC655466677CC655675686BDB866899988888898888665557666966598755476776SKMeRRRWVVWSTMEeWW9DFBRMF8BDFN84gbI99536647688227CF7CDDC66666GCMIIC8CDKDFIAA9AAAAA99C-FFIFFJFIAM91LJJLJHHNQKHFFL9C9EAEC7BC9AACCCCCCCCD988AIE92212222222333333333333323222235EC55CEDADPSUSWOJGGGDLLSUJHJICJTMOHLLP13FHKLDFB9MDGKI5ELIB789C81111111664CKSBQOF98C37GGAA71YMXKJMPEDCACBJH9FP8786555556333433333EK7BI55KIAFFHN5HGALFKLHCHHNKJJMJHLKLM--24646------EECDAD9EFFFEFFGEE-FGFEEEEEEGFEEEEEEEDHFGCE889EDEEEEEEDEEDEDEEFDCDDDEE81BDDDDDDDDDDD--2B3333356558CV8L444333244443115CB9AC69779HEOOPNMUYXGRSUSGLLO3212132226BDDLGGGGGJKMLMLMC9E9ACCC5545--L1666677211-11-22-2-------------------------37433656553G3 --------------1----------------------------------------------------------------------------------------------1------------------------------------------------1----1-1-------2-124----------7-----9---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 99.5 SQ:SECSTR ccEEEEEEcccHHHHHHHHHHHHTcTEEEEEccHHHHHHHHHHHcEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGHHGccHHHHHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHEEcHHHHHHHTccHHHHHHHHHHHHHHTTccEcccHHHHHHHHHTcEEEEEc# DISOP:02AL 219-220| PSIPRED ccccEEEEEccHHHHHHHHHHHHHccEEEEEccHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccEEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccEEHHHHHHHHHHHccccccccEEEEEEcEEEEEccccc //