[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35253.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  174/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.257.1
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->145 1sj5A PDBj 9e-67 94.2 %
:RPS:SCOP  54->142 1vjlA  d.257.1.1 * 5e-06 91.4 %
:HMM:SCOP  1->150 1vjlA_ d.257.1.1 * 4.6e-47 45.3 %
:RPS:PFM   6->149 PF02577 * DUF151 5e-31 48.9 %
:HMM:PFM   5->147 PF02577 * DUF151 2.2e-52 54.1 133/136  
:HMM:PFM   135->176 PF06757 * Ins_allergen_rp 7.3e-05 31.0 42/179  
:BLT:SWISS 1->166 Y1829_MYCTU 4e-21 35.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35253.1 GT:GENE AAD35253.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 165610..166155 GB:FROM 165610 GB:TO 166155 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000657 percent identity: 68.55; identified by sequence similarity; putative GB:PROTEIN_ID AAD35253.1 GB:DB_XREF GI:4980654 LENGTH 181 SQ:AASEQ MRKAWVKTLALDRVSNTPVVILGIEGTNRVLPIWIGACEGHALALAMEKMEFPRPLTHDLLLSVLESLEARVDKVIIHSLKDNTFYATLVIRDLTYTDEEDEEAALIDIDSRPSDAIILAVKTGAPIFVSDNLVEKHSIELEVNETQDEEEEFKKFVENLNIDTFKQMIEKKREEDEEGES GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 1->166|Y1829_MYCTU|4e-21|35.9|153/100| SEG 98->110|deedeeaalidid| SEG 170->180|ekkreedeege| BL:PDB:NREP 1 BL:PDB:REP 1->145|1sj5A|9e-67|94.2|137/143| RP:PFM:NREP 1 RP:PFM:REP 6->149|PF02577|5e-31|48.9|135/137|DUF151| HM:PFM:NREP 2 HM:PFM:REP 5->147|PF02577|2.2e-52|54.1|133/136|DUF151| HM:PFM:REP 135->176|PF06757|7.3e-05|31.0|42/179|Ins_allergen_rp| RP:SCP:NREP 1 RP:SCP:REP 54->142|1vjlA|5e-06|91.4|81/143|d.257.1.1| HM:SCP:REP 1->150|1vjlA_|4.6e-47|45.3|150/151|d.257.1.1|1/1|Hypothetical protein TM0160| OP:NHOMO 209 OP:NHOMOORG 201 OP:PATTERN ----------------1111111111111112-----------1--1-1-111--------------- 11111---------11111-11111111111111111111111111------1111-1--11111111111-------1-1-111222111111--1--1111111111----------------111111111111111111-111121111111111111111111111-1-----1-------1111-------------------------------------------------------------------------------------------------------------------------------------1---------------------------1---1----1--1-11111---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-111111--1--1-------------12-------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------------------------------------111111111111- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----112------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 80.1 SQ:SECSTR EEEEEEEEEEEcTTTccEEEEEEETTccEEEEEEccHHHHHHHHHHHTTcccccccHHHHHHHHHHHTTcEEEEEEEEEEETTEEEEEEEEEcccc#####ccccEEEEEEcHHHHHHHHHHHTccEEEEHHHHHHHcEEccHHHHHHHc############################### DISOP:02AL 1-2, 168-181| PSIPRED cEEEEEEEEEEEcccccEEEEEEEccccEEEEEEEcHHHHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEEEccccccccccccEEEEEEccccHHHHHHHHHcccEEEEHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccccccc //