[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35291.1
DDBJ      :             DNA repair protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  837/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.14.1g.41.5
:440 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   59->264 2cvfA PDBj 4e-08 24.9 %
:RPS:PDB   4->34 2crcA PDBj 7e-07 12.9 %
:RPS:PDB   58->271 3dvlC PDBj 8e-27 16.5 %
:RPS:SCOP  1->32 1b71A2  g.41.5.1 * 9e-07 31.2 %
:RPS:SCOP  55->261 1tf7A1  c.37.1.11 * 7e-23 20.8 %
:RPS:SCOP  278->431 1xhkA  d.14.1.10 * 1e-21 22.1 %
:HMM:SCOP  46->260 1g19A1 c.37.1.11 * 3e-46 38.5 %
:HMM:SCOP  241->432 1xhkA_ d.14.1.10 * 1.1e-28 34.6 %
:RPS:PFM   59->250 PF06745 * KaiC 1e-32 50.0 %
:HMM:PFM   60->262 PF06745 * KaiC 1e-15 31.8 195/226  
:BLT:SWISS 4->429 RADA_AQUAE 9e-84 40.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35291.1 GT:GENE AAD35291.1 GT:PRODUCT DNA repair protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 213146..214468 GB:FROM 213146 GB:TO 214468 GB:DIRECTION + GB:PRODUCT DNA repair protein GB:NOTE similar to SP:P24554 GB:X63155 PID:537229 PID:581233 GB:U00096 percent identity: 63.78; identified by sequence similarity; putative GB:PROTEIN_ID AAD35291.1 GB:DB_XREF GI:4980696 LENGTH 440 SQ:AASEQ MKKFVCSNCGYVSPKWFGRCPQCGEYDTAEEVQRRKNREGSPSLFLNLEDAGEISLERLSTGFSELDRAFRGGIVPGQVILLSGEPGIGKSTIALQIAERFAERGLVVYVSGEESPQQLKLRADRLLLKRKKDILLTLENDIDEIISSLQNKRVSFMVVDSIQTVFSSDLGSSPGSISQVKNVTMKTIDFAKRRGVPVLLVGHVTKEGEIAGPKLVEHMVDTVAYFEGDRRTGLRLLKITKNRFGPSDEVAVFELKENGFVQVENPSFTEGDADLPGNVLTCVFEGTKPFVVQIQALVSKNRTFSPKRVCKGVDVNRVMLLIAVISKYLKLPIETHDVYVNVVGGLRVTDPAADLAIALSIVSSYLEVSLHNTAAVGEIGLDGRVRKVYNINRRLNSLKSSGRIIVPPIEEEQKGVFEVRDLKEAVSIIGGEILGTPGAD GT:EXON 1|1-440:0| BL:SWS:NREP 1 BL:SWS:REP 4->429|RADA_AQUAE|9e-84|40.2|425/444| SEG 119->138|lklradrlllkrkkdilltl| SEG 167->178|ssdlgsspgsis| BL:PDB:NREP 1 BL:PDB:REP 59->264|2cvfA|4e-08|24.9|205/220| RP:PDB:NREP 2 RP:PDB:REP 4->34|2crcA|7e-07|12.9|31/52| RP:PDB:REP 58->271|3dvlC|8e-27|16.5|206/486| RP:PFM:NREP 1 RP:PFM:REP 59->250|PF06745|1e-32|50.0|182/202|KaiC| HM:PFM:NREP 1 HM:PFM:REP 60->262|PF06745|1e-15|31.8|195/226|KaiC| RP:SCP:NREP 3 RP:SCP:REP 1->32|1b71A2|9e-07|31.2|32/44|g.41.5.1| RP:SCP:REP 55->261|1tf7A1|7e-23|20.8|202/242|c.37.1.11| RP:SCP:REP 278->431|1xhkA|1e-21|22.1|154/185|d.14.1.10| HM:SCP:REP 46->260|1g19A1|3e-46|38.5|213/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 241->432|1xhkA_|1.1e-28|34.6|162/0|d.14.1.10|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 874 OP:NHOMOORG 858 OP:PATTERN -------------------------------------------------------------------- ----11111111-111111-11--1111111-11111111111111-11111111111--111111111111111111----111111111111111--11111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111-11111--1111111111111111-11-111111111111111111111111111111111111111121111111111211111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111--11111111-----1-111--------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-1-7111111121-15112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 29-56, 168-181, 299-310, 438-440| PSIPRED ccEEEEcccccccccccEEcccccccccEEEEEccccccccccEEEEcccHHHccccccccccHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccccEEEEcHHHHHHHHHHHHHccccEEEEEcHHHHccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccccEEHHHHHEEEEEEccccccEEEEEEHHHccccccEEEEEEcccccEEEccccccccccccccEEEEEEEEccccccEEEEEEEEcccccccccEEEEEEHHHHHHHHHHHHHHHHccccccccEEEEEcccEEcccccccHHHHHHHHHHHHcccccccEEEEEEEccEEEEEcccHHHHHHHHHHccEEEEEccccccccEEccccHHHHHHHHccccccccccc //