[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35308.1
DDBJ      :             glycyl-tRNA synthetase, alpha subunit
Swiss-Prot:SYGA_THEMA   RecName: Full=Glycyl-tRNA synthetase alpha subunit;         EC=6.1.1.14;AltName: Full=Glycine--tRNA ligase alpha subunit;         Short=GlyRS;

Homologs  Archaea  0/68 : Bacteria  670/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:286 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->280 1j5wB PDBj e-146 100.0 %
:RPS:PDB   106->286 2du7A PDBj 6e-14 13.3 %
:RPS:SCOP  2->281 1j5wA  d.104.1.1 * e-127 93.1 %
:HMM:SCOP  1->281 1j5wA_ d.104.1.1 * 7e-141 64.8 %
:RPS:PFM   4->286 PF02091 * tRNA-synt_2e e-115 65.4 %
:HMM:PFM   3->284 PF02091 * tRNA-synt_2e 3.9e-148 66.0 282/284  
:BLT:SWISS 1->286 SYGA_THEMA e-162 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35308.1 GT:GENE AAD35308.1 GT:PRODUCT glycyl-tRNA synthetase, alpha subunit GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 230581..231441 GB:FROM 230581 GB:TO 231441 GB:DIRECTION + GB:PRODUCT glycyl-tRNA synthetase, alpha subunit GB:NOTE similar to GB:AE000657 percent identity: 82.92; identified by sequence similarity; putative GB:PROTEIN_ID AAD35308.1 GB:DB_XREF GI:4980714 LENGTH 286 SQ:AASEQ MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTDGRYGENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWNENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQANENSPA GT:EXON 1|1-286:0| SW:ID SYGA_THEMA SW:DE RecName: Full=Glycyl-tRNA synthetase alpha subunit; EC=6.1.1.14;AltName: Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS; SW:GN Name=glyQ; OrderedLocusNames=TM_0216; SW:KW 3D-structure; Aminoacyl-tRNA synthetase; ATP-binding;Complete proteome; Cytoplasm; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->286|SYGA_THEMA|e-162|100.0|286/286| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| SEG 86->99|ensqelylesleyl| BL:PDB:NREP 1 BL:PDB:REP 2->280|1j5wB|e-146|100.0|272/272| RP:PDB:NREP 1 RP:PDB:REP 106->286|2du7A|6e-14|13.3|166/539| RP:PFM:NREP 1 RP:PFM:REP 4->286|PF02091|e-115|65.4|283/284|tRNA-synt_2e| HM:PFM:NREP 1 HM:PFM:REP 3->284|PF02091|3.9e-148|66.0|282/284|tRNA-synt_2e| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF02091|IPR002310| GO:PFM GO:0004820|"GO:glycine-tRNA ligase activity"|PF02091|IPR002310| GO:PFM GO:0005524|"GO:ATP binding"|PF02091|IPR002310| GO:PFM GO:0005737|"GO:cytoplasm"|PF02091|IPR002310| GO:PFM GO:0006412|"GO:translation"|PF02091|IPR002310| GO:PFM GO:0006426|"GO:glycyl-tRNA aminoacylation"|PF02091|IPR002310| RP:SCP:NREP 1 RP:SCP:REP 2->281|1j5wA|e-127|93.1|275/276|d.104.1.1| HM:SCP:REP 1->281|1j5wA_|7e-141|64.8|281/281|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 698 OP:NHOMOORG 687 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------111--------------111---1-------------1111-11111----------------------111111111111111---------------------1112111111111111111111111111111111111-----111--1---------------111111-------11111111111--------------------1111111111111111111111111111111111111111111111111111111111111111111111----------------1---------1-1--111111111111----111-1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2----11117111111111-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 99.0 SQ:SECSTR #cHHHHH#HHHHHHHTTTcEEccccc#ccccGGGcHHHHTGGGccccEEEEEEEEEEcGGGccTTcccccccEEEEEEEEEEcccTTHHHHHHHHHHHHTccTcccTTTcEEEEEccccccccEEEEEEEEEEEccHHHHHHEEcTTccccEEEEEEcEEHHHHHHHHTTccccHHHHccccccccccHHHHHTHTcccccccccHHHHHHHHHHHHHHccccccccccccccHHHHcccccccccccccEEccccccHHTTccccccccccccEEETTEEccccc DISOP:02AL 284-286| PSIPRED ccHHHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHcccccccEEEEEcccccccccccccccHHHcEEEEEEEEEEcccccHHHHHHHHHHHHcccHHHccEEEEEEccccccccccccccEEEEcccccccccHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHccccccccEEEEEEccHHHHHHEEcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //