[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35380.1
DDBJ      :             3-isopropylmalate dehydratase, small subunit, putative
Swiss-Prot:LEUD1_THEMA  RecName: Full=3-isopropylmalate dehydratase small subunit 1;         EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase 1;AltName: Full=Alpha-IPM isomerase 1;         Short=IPMI 1;

Homologs  Archaea  56/68 : Bacteria  451/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
c.8.2
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->159 2pkpA PDBj 2e-35 49.7 %
:RPS:PDB   5->159 1c97A PDBj 2e-35 22.2 %
:RPS:SCOP  1->163 1v7lA  c.8.2.1 * 4e-42 46.5 %
:HMM:SCOP  1->161 1l5jA2 c.8.2.1 * 3.9e-50 46.5 %
:RPS:PFM   54->107 PF00694 * Aconitase_C 4e-15 57.4 %
:HMM:PFM   40->106 PF00694 * Aconitase_C 2.5e-22 52.3 65/131  
:HMM:PFM   91->127 PF11515 * Cul7 0.00036 27.0 37/79  
:BLT:SWISS 1->166 LEUD1_THEMA 6e-94 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35380.1 GT:GENE AAD35380.1 GT:PRODUCT 3-isopropylmalate dehydratase, small subunit, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 310542..311042 GB:FROM 310542 GB:TO 311042 GB:DIRECTION + GB:PRODUCT 3-isopropylmalate dehydratase, small subunit, putative GB:NOTE similar to GB:AE000782 percent identity: 80.00; identified by sequence similarity; putative GB:PROTEIN_ID AAD35380.1 GB:DB_XREF GI:4980791 LENGTH 166 SQ:AASEQ MIRGRVWKFGDNISTDHIAPGRYFHLRNNLEELAKHVLEDAMEDFAKKVQKGDIIVAGKNFGLGSSREHAARIIKIAGVSCIVAKSFARIFYRNAINVGLPVIELKEVDEINQGDELEIDLENGVLKNLTTGKEYRFTPIPKFLLEILKEDGIVNYLKKHGSFPKV GT:EXON 1|1-166:0| SW:ID LEUD1_THEMA SW:DE RecName: Full=3-isopropylmalate dehydratase small subunit 1; EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase 1;AltName: Full=Alpha-IPM isomerase 1; Short=IPMI 1; SW:GN Name=leuD1; OrderedLocusNames=TM_0292; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; Leucine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->166|LEUD1_THEMA|6e-94|100.0|166/166| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0009098|"GO:leucine biosynthetic process"|Leucine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 1->159|2pkpA|2e-35|49.7|157/167| RP:PDB:NREP 1 RP:PDB:REP 5->159|1c97A|2e-35|22.2|153/753| RP:PFM:NREP 1 RP:PFM:REP 54->107|PF00694|4e-15|57.4|54/130|Aconitase_C| HM:PFM:NREP 2 HM:PFM:REP 40->106|PF00694|2.5e-22|52.3|65/131|Aconitase_C| HM:PFM:REP 91->127|PF11515|0.00036|27.0|37/79|Cul7| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00694|IPR000573| RP:SCP:NREP 1 RP:SCP:REP 1->163|1v7lA|4e-42|46.5|159/162|c.8.2.1| HM:SCP:REP 1->161|1l5jA2|3.9e-50|46.5|159/212|c.8.2.1|1/1|LeuD/IlvD-like| OP:NHOMO 859 OP:NHOMOORG 623 OP:PATTERN ---2--1111111211-1111112211122222222222222222222323322221-1--2--2-22 12--1----------11--------3-----------122------1------------------11------------11-222111111111---11--1-2211111---------------111111111112113122221111-11111111-11111-12112111111111111122222221--1111111111111111-1----111----1--------1--11111111111111111-1----------------------11-1-------111------------------------111111111-23-22111111121232221---1-21--212211222211222222--2-2-1111-----21-22-11-----11111111111---1--1---11-111111111111-111-111-1--1-1--------1---11-1-----------------------------111111122-1---1-------1121-----11112211--------------111------1--------------12111222122221-222222222----12231111111111--1-------1111111111---1---111---1-1111-1-1--11---1---------11--1-11111111111-11-11111111111111121111--1-111111111111111111111111--111111111111------------------1111-1-----1111-------111-------11--1---1------------111111111111111-----------------122-----------------------------------------12--2-222111 ------1------124322233234232222222222212-22222111322422221212223221113122132212212222211-1213222111122-211-111-----------------------------------------------------------------1111911-112141231112222- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 97.0 SQ:SECSTR EETTGGTccHHHHGGGTTTTcccTTTTTccTcEEcTTTccEEcHHHHHHTccEEEEcccccTcccccTHHHHHHHHTTEEEEEEccccHHHHHHHHHTTcEEEEEccGGGccTTcEEEEEcGGGccTTccTccEEEEEEccHHHHHHHHHccHHHHHHHHT##### DISOP:02AL 165-166| PSIPRED cEEEEEEEccccccHHHccccHHHcccccHHHHHHHHHHcccccHHHHHccccEEEEccEEccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEEEccccccccccEEEEEEcccEEEEccccEEEEEEEccHHHHHHHHcccccHHHHHccccccc //