[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35394.1
DDBJ      :             alpha-L-fucosidase, putative
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  87/915 : Eukaryota  86/199 : Viruses  0/175   --->[See Alignment]
b.71.1c.1.8
:449 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->448 1hl9B PDBj 0.0 100.0 %
:RPS:PDB   4->70 1bccG PDBj 1e-09 8.9 %
:RPS:SCOP  7->356 1hl8A2  c.1.8.11 * e-140 99.1 %
:RPS:SCOP  357->447 1hl8A1  b.71.1.3 * 1e-50 100.0 %
:HMM:SCOP  7->356 1hl9A2 c.1.8.11 * 5.9e-127 51.7 %
:HMM:SCOP  357->448 1hl9A1 b.71.1.3 * 2.5e-58 100.0 %
:RPS:PFM   20->349 PF01120 * Alpha_L_fucos 5e-57 52.4 %
:HMM:PFM   5->357 PF01120 * Alpha_L_fucos 1.1e-106 47.4 321/347  
:BLT:SWISS 7->398 FUCO2_HUMAN 4e-68 43.2 %
:REPEAT 2|58->175|178->297

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35394.1 GT:GENE AAD35394.1 GT:PRODUCT alpha-L-fucosidase, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 326116..327465 GB:FROM 326116 GB:TO 327465 GB:DIRECTION + GB:PRODUCT alpha-L-fucosidase, putative GB:NOTE similar to GB:M29877 SP:P04066 PID:1335066 PID:178409 PID:182779 percent identity: 56.91; identified by sequence similarity; putative GB:PROTEIN_ID AAD35394.1 GB:DB_XREF GI:4980806 LENGTH 449 SQ:AASEQ MISMKPRYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVEE GT:EXON 1|1-449:0| BL:SWS:NREP 1 BL:SWS:REP 7->398|FUCO2_HUMAN|4e-68|43.2|361/467| NREPEAT 1 REPEAT 2|58->175|178->297| BL:PDB:NREP 1 BL:PDB:REP 7->448|1hl9B|0.0|100.0|426/426| RP:PDB:NREP 1 RP:PDB:REP 4->70|1bccG|1e-09|8.9|56/78| RP:PFM:NREP 1 RP:PFM:REP 20->349|PF01120|5e-57|52.4|286/312|Alpha_L_fucos| HM:PFM:NREP 1 HM:PFM:REP 5->357|PF01120|1.1e-106|47.4|321/347|Alpha_L_fucos| GO:PFM:NREP 2 GO:PFM GO:0004560|"GO:alpha-L-fucosidase activity"|PF01120|IPR000933| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01120|IPR000933| RP:SCP:NREP 2 RP:SCP:REP 7->356|1hl8A2|e-140|99.1|335/335|c.1.8.11| RP:SCP:REP 357->447|1hl8A1|1e-50|100.0|91/91|b.71.1.3| HM:SCP:REP 7->356|1hl9A2|5.9e-127|51.7|350/0|c.1.8.11|1/1|(Trans)glycosidases| HM:SCP:REP 357->448|1hl9A1|2.5e-58|100.0|92/92|b.71.1.3|1/1|Glycosyl hydrolase domain| OP:NHOMO 467 OP:NHOMOORG 181 OP:PATTERN --------1111112--1-------------------------------------------------- 215-4-------------------1------1------------124-----2----1-----2--1111-----3------------8887-122----12-1-9-3-6-----------------------------22---1---1--------------------1------------------11------------------------------------------6------------------------23---------32----------------1-----11-1---------------------------1-------------------2113----------------------1-----1211-------------------------------------------1---11-2-1-----1----------------------------------------------------------1--------------1------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------222222221111------------------1--------------------------------1-111-34 ----22---------11-1-----1-1-----------------------12-2--4----------------------------------21-2--------2---11-23483322222222421427I2-336222222221222222226122236FB4FE41211351B2----------2--3-163------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 432 STR:RPRED 96.2 SQ:SECSTR ###ccccccccccTTcccccccTTTTHHHHHHHHHHHHHHHHHccc########HHHHHHHHHHHTTcccHHHcTTcHHHHHHHHHTcTTccGGGHHHHcccTTccHHHHHHHHHHHTccEEEEEEEcTTcccccccTTccccTTTcTTcccHHHHHHHHHHHTTcEEcEEEcccccTTccccccccGGGGGTcccccHHHHHHHHHHHHHHHHHHcccEEEEcccccGGGTTHHHHHHHHHHHHcTTcEEcccccccccccEEEccc#####ccccccEEEEEEccccccccTTccTTccccHHHHHHHHHHHHHTTEEEEEEEcccTTccccHHHHHHHHHHHHHHHHHGGGTTTcccccccEEEcccccEEEEEEETTEEEEEEcccccccEEEETTccccccEEEETTTccEEEEEEETTEEEEEccHHHHTTcccccEEEEEc# DISOP:02AL 1-5, 8-10| PSIPRED ccccccccccccccHHccccHHHHHHccEEEEEEEccHHccccccccccccccccHHHHccccHHHHHcccccccccHHEEHHHHHcccccccHHHHcccccccccHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHcccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHHHccHHHcccccccccccccccccEEEEEccccEEEEEEEccccccEEEEccccccccEEEEEEccEEEEEEEccccEEEEEcHHHcccccEEEEEEEEcc //