[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35418.1
DDBJ      :             orotate phosphoribosyltransferase
Swiss-Prot:PYRE_THEMA   RecName: Full=Orotate phosphoribosyltransferase;         Short=OPRT;         Short=OPRTase;         EC=2.4.2.10;

Homologs  Archaea  32/68 : Bacteria  190/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.61.1
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->148 2wnsB PDBj 6e-10 30.1 %
:RPS:PDB   19->160 3dezB PDBj 2e-20 21.5 %
:RPS:SCOP  6->176 2aeeA1  c.61.1.1 * 2e-17 20.1 %
:HMM:SCOP  1->180 1o57A2 c.61.1.1 * 3.7e-39 32.8 %
:RPS:PFM   56->136 PF00156 * Pribosyltran 7e-06 43.2 %
:HMM:PFM   43->137 PF00156 * Pribosyltran 1.2e-18 35.8 95/125  
:BLT:SWISS 1->187 PYRE_THEMA e-105 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35418.1 GT:GENE AAD35418.1 GT:PRODUCT orotate phosphoribosyltransferase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(351382..351945) GB:FROM 351382 GB:TO 351945 GB:DIRECTION - GB:PRODUCT orotate phosphoribosyltransferase GB:NOTE similar to PID:882414 PID:1754506 percent identity: 72.22; identified by sequence similarity; putative GB:PROTEIN_ID AAD35418.1 GB:DB_XREF GI:4980832 LENGTH 187 SQ:AASEQ MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETVVGPAMGGVILSYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSIIDRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEKPGSRGLK GT:EXON 1|1-187:0| SW:ID PYRE_THEMA SW:DE RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT; Short=OPRTase; EC=2.4.2.10; SW:GN Name=pyrE; OrderedLocusNames=TM_0331; SW:KW Complete proteome; Glycosyltransferase; Magnesium;Pyrimidine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->187|PYRE_THEMA|e-105|100.0|187/187| GO:SWS:NREP 3 GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0006221|"GO:pyrimidine nucleotide biosynthetic process"|Pyrimidine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| TM:NTM 1 TM:REGION 56->78| BL:PDB:NREP 1 BL:PDB:REP 15->148|2wnsB|6e-10|30.1|133/199| RP:PDB:NREP 1 RP:PDB:REP 19->160|3dezB|2e-20|21.5|135/194| RP:PFM:NREP 1 RP:PFM:REP 56->136|PF00156|7e-06|43.2|81/116|Pribosyltran| HM:PFM:NREP 1 HM:PFM:REP 43->137|PF00156|1.2e-18|35.8|95/125|Pribosyltran| GO:PFM:NREP 1 GO:PFM GO:0009116|"GO:nucleoside metabolic process"|PF00156|IPR000836| RP:SCP:NREP 1 RP:SCP:REP 6->176|2aeeA1|2e-17|20.1|169/204|c.61.1.1| HM:SCP:REP 1->180|1o57A2|3.7e-39|32.8|180/202|c.61.1.1|1/1|PRTase-like| OP:NHOMO 239 OP:NHOMOORG 228 OP:PATTERN --11--1-1111111111-1---2--------1-111------------1311-1111111-1-1--- --2-----111---1--------------------------------------------------------------------1-111-------------------------------------11111111111111--111-1111---111-----1--11--1112------------11111112------------------------------------------------------------------------------------------------------------------------------------111--1111111-1--1111111-1-111--1-111111111111111--1-1111111111--1----------11111111111-1111111--11---------------111--------------------------1111111111---------------1111111111-------------------------------------------------------------------------1---1-1--1111-----1--------11-111111111111111111111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-1111111111- --------211----------------------------------------------------------------------------------------------------------------------------------------------------13-----------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 94.1 SQ:SECSTR cccHHHHHHTcEEEcTTcTcccccccEEEcGGGGGGcHHHHHHHHHHHHHHHHHHTccEEEEETTTTHHHHHHHHHHTTccEEEEcccccccEEcEEccccTTcEEEEEEEEEcccHHHHHHHHHHHHTTcEEEEEEEEEEcccHHHHHTccEEEcccHHGGccccccccccccHH########### DISOP:02AL 184-187| PSIPRED cHHHHHHHcccEEcccEEEEEcccccEEEEcHHHHccHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHcccEEEEEEEccccEEEEccccccccEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccEEEEEEEEEEccccccccHHHHccccccccccccc //