[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35420.1
DDBJ      :             dihydroorotate dehydrogenase
Swiss-Prot:PYRD_THEP1   RecName: Full=Dihydroorotate dehydrogenase;         EC=1.3.3.1;AltName: Full=Dihydroorotate oxidase;AltName: Full=DHOdehase;         Short=DHODase;         Short=DHOD;

Homologs  Archaea  52/68 : Bacteria  381/915 : Eukaryota  66/199 : Viruses  0/175   --->[See Alignment]
c.1.4
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->261 1ep3A PDBj 6e-41 38.4 %
:RPS:PDB   2->270 3c61A PDBj 3e-23 26.3 %
:RPS:SCOP  2->269 1gt8A2  c.1.4.1 * 5e-42 28.3 %
:HMM:SCOP  2->267 1uumA_ c.1.4.1 * 2.8e-51 38.5 %
:RPS:PFM   2->265 PF01180 * DHO_dh 2e-27 39.5 %
:HMM:PFM   3->266 PF01180 * DHO_dh 2.5e-45 35.3 258/293  
:BLT:SWISS 1->270 PYRD_THEP1 e-155 100.0 %
:PROS 30->49|PS00911|DHODEHASE_1
:PROS 222->242|PS00912|DHODEHASE_2
:REPEAT 2|141->176|213->245

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35420.1 GT:GENE AAD35420.1 GT:PRODUCT dihydroorotate dehydrogenase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(352544..353356) GB:FROM 352544 GB:TO 353356 GB:DIRECTION - GB:PRODUCT dihydroorotate dehydrogenase GB:NOTE similar to GB:M59757 SP:P25996 PID:143392 GB:AL009126 percent identity: 61.40; identified by sequence similarity; putative GB:PROTEIN_ID AAD35420.1 GB:DB_XREF GI:4980834 LENGTH 270 SQ:AASEQ MLELKPPLVLLSGPAGFGEYLKLMDHRYVGGVLLKTVTLHPKEGNPTPRMADSDFYVINRIGLENPGIHAFVENIPELPVPMIASLGGDSFEEYLEVARVFKKVADRFYAVEFNFSCPNVKEGGLSIVKNAEEWKKLLNTLRKELPDSFLIAKVGVEGIFVEDAAEFVMKTGWDGITLVNTVRGLHFEKDTMILGGLSGPVLKPIALRAVYEVKKRFPELFVIASGGVYSVKDAEEFLKVGADVIGVGSALFKDPGVVEEIGKYLLEVKR GT:EXON 1|1-270:0| SW:ID PYRD_THEP1 SW:DE RecName: Full=Dihydroorotate dehydrogenase; EC=1.3.3.1;AltName: Full=Dihydroorotate oxidase;AltName: Full=DHOdehase; Short=DHODase; Short=DHOD; SW:GN Name=pyrD; OrderedLocusNames=Tpet_0586; SW:KW Complete proteome; Cytoplasm; Flavoprotein; FMN; Oxidoreductase;Pyrimidine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->270|PYRD_THEP1|e-155|100.0|270/270| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006221|"GO:pyrimidine nucleotide biosynthetic process"|Pyrimidine biosynthesis| PROS 30->49|PS00911|DHODEHASE_1|PDOC00708| PROS 222->242|PS00912|DHODEHASE_2|PDOC00708| NREPEAT 1 REPEAT 2|141->176|213->245| BL:PDB:NREP 1 BL:PDB:REP 2->261|1ep3A|6e-41|38.4|255/311| RP:PDB:NREP 1 RP:PDB:REP 2->270|3c61A|3e-23|26.3|266/314| RP:PFM:NREP 1 RP:PFM:REP 2->265|PF01180|2e-27|39.5|258/290|DHO_dh| HM:PFM:NREP 1 HM:PFM:REP 3->266|PF01180|2.5e-45|35.3|258/293|DHO_dh| GO:PFM:NREP 3 GO:PFM GO:0004152|"GO:dihydroorotate dehydrogenase activity"|PF01180|IPR012135| GO:PFM GO:0006222|"GO:UMP biosynthetic process"|PF01180|IPR012135| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01180|IPR012135| RP:SCP:NREP 1 RP:SCP:REP 2->269|1gt8A2|5e-42|28.3|265/310|c.1.4.1| HM:SCP:REP 2->267|1uumA_|2.8e-51|38.5|262/0|c.1.4.1|1/1|FMN-linked oxidoreductases| OP:NHOMO 576 OP:NHOMOORG 499 OP:PATTERN 11111111111111111------1-----1-111111111111111-111--1111111111111-11 1111--------------------1---------------1-----------------11---1--1---11111111111111111111111111---1---1--1--1---------------11111111111---1-111---------------------1--------1-----------11111-11111111111111111111111111111-1111111111-1--------------1----21-222211111122111111-12221111111222222222222221111111111111212222222111111111112112112111111131111111111111111111111111111------------------------------------1----------11-----1--11--1-----------11111111-111-1--11------11----------------1-1-----------211112---------------111------------------------1---2--111111-----111111111111111111111111------1111---111111-1-------1111------1---1-------------------------1-11-------------1111111111-1111111111111111111------1-1-1-1111111-1--1--1----1------------------111111111-1----------------------------------------1---------------1----------------------------1111--1-----------1--------------------1------1-11111111--- ----111--11-11------------------------------------------------1----11-1----111111-----1------111-------111----231122-1-11-1-1212-271-24111-1-1-21-11-111---211-1361-2-----8--11------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 100.0 SQ:SECSTR HEEEcccEEEcTcTTcccHHHHHHHHcccccEEEEEEccccccccccccEEEETTEEEEccccccccHHHHHHHHHHTcccEEEEEccccHHHHHHHHHHHHHHHHHccEEEEEccccccTTTcccGGGcHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHTcTTEEEEEEcccEEEEEcEETGGEEEEEGGGGHHHHHHHHHHHHHHcTTcEEEEEcccccHHHHHHHHHHTEEEEEEcHHHHHHcTHHHHHHHHHHHHHH DISOP:02AL 270-271| PSIPRED cccccccEEEcccccccHHHHHHHHHccccEEEEcccccccccccccccEEEcccccccccccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHcccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHHHHcc //