Thermotoga maritima MSB8 (tmar0)
Gene : AAD35425.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:35 amino acids
:HMM:PFM   4->28 PF04254 * DUF432 0.00015 24.0 25/123  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35425.1 GT:GENE AAD35425.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(358307..358414) GB:FROM 358307 GB:TO 358414 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35425.1 GB:DB_XREF GI:4980840 LENGTH 35 SQ:AASEQ MRIILKKEVRKMFVLIPVDVLIAIHSEKIGQKRNR GT:EXON 1|1-35:0| TM:NTM 1 TM:REGION 12->29| HM:PFM:NREP 1 HM:PFM:REP 4->28|PF04254|0.00015|24.0|25/123|DUF432| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 30-35| PSIPRED ccEEHHHHHHHHHHHccHHHHHHHHHHHccccccc //