[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35428.1
DDBJ      :             permease, putative
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  274/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:413 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  9->382 1pv6A  f.38.1.2 * 2e-04 15.1 %
:HMM:SCOP  1->410 1pv7A_ f.38.1.2 * 2.1e-47 23.8 %
:RPS:PFM   9->380 PF05977 * DUF894 7e-32 32.9 %
:HMM:PFM   14->337 PF07690 * MFS_1 2.4e-34 23.4 308/353  
:HMM:PFM   319->406 PF07690 * MFS_1 1.9e-09 22.7 88/353  
:BLT:SWISS 9->389 YKUC_BACSU 2e-15 25.6 %
:TM
:REPEAT 2|63->164|276->377
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35428.1 GT:GENE AAD35428.1 GT:PRODUCT permease, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 359675..360916 GB:FROM 359675 GB:TO 360916 GB:DIRECTION + GB:PRODUCT permease, putative GB:NOTE similar to GB:Pyro_h percent identity: 66.03; identified by sequence similarity; putative GB:PROTEIN_ID AAD35428.1 GB:DB_XREF GI:4980843 LENGTH 413 SQ:AASEQ MNEILHWKRNFFLLALGRFVSILGSSVQAVAIPLFVLDLTHSGSAVALMTVAYMVPRILFTPIAGIVGDRGDRKFLMVSMDFLRGFLICFLALLAFRNSITLPVLYVSQIAMAIMDNLFDIPTGAMFPDIVPQDFLMRANSIMGMVRIFPQILGPALGGVIYGFYGIAIVFLVNGVSFVLSAISEIFIVYSRKVEKKPAKFSQILEDLKEGFLFIWNHELIRTILIFALFLNLLISPLFMVVYPYTIREVMKFSAQEFGFLETSFTLGALLGNFLIASYLSKKNMWKAMKISIFLFELPIVFLGFLVMPDFSLNRLVLFSLFFITFLIMGFLNPIINVPLDTAFQKMTPSHIRARAFSFLILVANGVTPLGSVLYGYLVDRVPVHFLYYVVGALSFLVAVLLLVALRGKELPT GT:EXON 1|1-413:0| BL:SWS:NREP 1 BL:SWS:REP 9->389|YKUC_BACSU|2e-15|25.6|363/430| TM:NTM 10 TM:REGION 13->35| TM:REGION 46->68| TM:REGION 75->97| TM:REGION 105->127| TM:REGION 170->191| TM:REGION 220->242| TM:REGION 287->309| TM:REGION 318->340| TM:REGION 355->377| TM:REGION 385->407| NREPEAT 1 REPEAT 2|63->164|276->377| SEG 224->235|ilifalflnlli| SEG 390->406|vvgalsflvavlllval| RP:PFM:NREP 1 RP:PFM:REP 9->380|PF05977|7e-32|32.9|359/402|DUF894| HM:PFM:NREP 2 HM:PFM:REP 14->337|PF07690|2.4e-34|23.4|308/353|MFS_1| HM:PFM:REP 319->406|PF07690|1.9e-09|22.7|88/353|MFS_1| RP:SCP:NREP 1 RP:SCP:REP 9->382|1pv6A|2e-04|15.1|358/417|f.38.1.2| HM:SCP:REP 1->410|1pv7A_|2.1e-47|23.8|395/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 631 OP:NHOMOORG 286 OP:PATTERN --------------------------------------------1-----21--2-11111------- 1571A---------2----------1-----------222---124--123122-1-1--13--11-323-----222--1-------11---1-----1-2-1131--2---------------11111--111111233---82511522------------21-5541-----------------21121499998AAC2BE967B634443DA51-14213------D2111-------111--111-1---1221----11--44----1-1-------1121-12211111211----1--------1---------24244-------1--2244----2-1-12---165211-41121111-1-111-11---1----11-------1------------------1---1--2--1---111----1---------------------11---------------------------------1-1----------1111-11111--111111----1---11-111--------31------1-1-------------1-1-------------2--2-1--1----51111---1-----1--------------------------------2--------------------------1-12-------------------------------------111--1----------------------------------------11111------112--------------------------1---------1111-2111----1---------------------1-11-------------------------2-1-------------------------2451121222--- ----11-------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 189-207, 412-413| PSIPRED ccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //