[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35487.1
DDBJ      :             ammonium transporter
Swiss-Prot:             

Homologs  Archaea  48/68 : Bacteria  639/915 : Eukaryota  135/199 : Viruses  0/175   --->[See Alignment]
f.44.1
:435 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->426 2nuuD PDBj 1e-46 38.8 %
:RPS:PDB   30->426 2b2fA PDBj 6e-93 31.7 %
:RPS:SCOP  30->407 1u77A  f.44.1.1 * 1e-81 31.4 %
:HMM:SCOP  26->407 1u7gA_ f.44.1.1 * 1.9e-119 46.9 %
:RPS:PFM   34->424 PF00909 * Ammonium_transp 2e-72 46.5 %
:HMM:PFM   34->426 PF00909 * Ammonium_transp 5.3e-134 47.3 387/399  
:BLT:SWISS 45->429 Y108_SYNY3 3e-84 50.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35487.1 GT:GENE AAD35487.1 GT:PRODUCT ammonium transporter GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 422169..423476 GB:FROM 422169 GB:TO 423476 GB:DIRECTION + GB:PRODUCT ammonium transporter GB:NOTE similar to GB:AE000782 percent identity: 67.74; identified by sequence similarity; putative GB:PROTEIN_ID AAD35487.1 GB:DB_XREF GI:4980907 LENGTH 435 SQ:AASEQ MRKRVFSLLLVLAFLSVGFAQDGVTDVGWSLDMVWILISAALVFFMQAGFAMVESGFTRAKNTVNVLMKNLMDFAIGSVVFFIFGYWIMFGKHPLTFDPSTKEGLWDFAMWMFQMAFAGTAATIVSGAMAERTKFPAYLAYTGFITGIIYSVVGRWIWGGGWLAQKGFIDFAGSTVVHSVGGWAAMIGASLLGPRFGKYDSQGNPKPIPGHNIPLAALGTFILWFGWFGFNGGSTLAGTNGAIGMIILNTNLAAATGALAAMVTVWAKYGKPDASMTMNGALAGLVAITAPCAVVSPVSSLIIGAIGGVIVVFAVEFFDKVLKIDDPVGAISVHGVNGAWGTLAVGLFAESKYALASGMGDVNGLFFGGGVHQLGVQFLGVVSVFAWTVVTSFLVFWFIKKTIGLRVDRDIELKGLDIEEHGMEGYADFEIFTTR GT:EXON 1|1-435:0| BL:SWS:NREP 1 BL:SWS:REP 45->429|Y108_SYNY3|3e-84|50.4|371/507| TM:NTM 12 TM:REGION 5->27| TM:REGION 30->52| TM:REGION 70->91| TM:REGION 106->128| TM:REGION 139->161| TM:REGION 172->194| TM:REGION 209->229| TM:REGION 244->265| TM:REGION 278->300| TM:REGION 303->325| TM:REGION 337->359| TM:REGION 376->398| SEG 5->20|vfslllvlaflsvgfa| SEG 248->261|lntnlaaatgalaa| SEG 302->318|iigaiggvivvfaveff| BL:PDB:NREP 1 BL:PDB:REP 32->426|2nuuD|1e-46|38.8|379/410| RP:PDB:NREP 1 RP:PDB:REP 30->426|2b2fA|6e-93|31.7|382/391| RP:PFM:NREP 1 RP:PFM:REP 34->424|PF00909|2e-72|46.5|383/395|Ammonium_transp| HM:PFM:NREP 1 HM:PFM:REP 34->426|PF00909|5.3e-134|47.3|387/399|Ammonium_transp| GO:PFM:NREP 4 GO:PFM GO:0006810|"GO:transport"|PF00909|IPR001905| GO:PFM GO:0008519|"GO:ammonium transmembrane transporter activity"|PF00909|IPR001905| GO:PFM GO:0016020|"GO:membrane"|PF00909|IPR001905| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00909|IPR001905| RP:SCP:NREP 1 RP:SCP:REP 30->407|1u77A|1e-81|31.4|366/383|f.44.1.1| HM:SCP:REP 26->407|1u7gA_|1.9e-119|46.9|367/383|f.44.1.1|1/1|Ammonium transporter| OP:NHOMO 1585 OP:NHOMOORG 822 OP:PATTERN ---1--1111111111---1-1131--112111121222233122212113321-------111--22 32211--222211122211-13--2311111132222333111111--11-1223111--111-1-12111-111-----1-111212--111--------2-1114111---------------2312122212211-11111315122113112211121133212223111111112111211111--211--1-1111-111111112211111-11111111111113-11111111111111-111111111111-1-111122-1-111--11111----11---------------------------111----11-13------------22------1--1111111311---1111-2---1131111-----122221-112--211111111111-22121121114-1111111111111111212111111231111111122211212-----------------------------422111111-12222222111122221111112222222-122152-112322212322323131111111---242-3231232122112-222222233222312111--1----------------2122133122122212131222222222211111112----112------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111-------------43213------------11-22222131111222222223323223222---------41112-11111222211111111111111113-331122---------------------------------222-11--1-11111- ----333-----1124353433334431111111112222222---132235442332223354323212314233323322343323-24234392221222445-3N4I------------------------------------------------23A-8552112-54B327A5*43452C8BL5747654669 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 397 STR:RPRED 91.3 SQ:SECSTR #############################HHHHHHHHHHHHHHHHHHHHHHHHHHTTccGGGHHHHHHHHHHHHHHHHHHHHHTHHHHHHccEETTTEEccTTGGGHHHHHHHHHHHHHHHHHHHGGGGTTTccHHHHHHHHHHHHHHTHHHHHHHHHcccHHHHTTccccccTTTTHHHHHHHHHHHHHHHcccTTTTTHHHHHcccccccHHHHHHHHHHHHHHHHHHHHGGGccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHTTTTTTccHHHHHHHHHHHHHHHHHHHHHHHHHTTcccTTcHHHHHHHHHHHHHHHHHHHccHHHHccTcccccTccGGGTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHcHHHHHHccccc######### DISOP:02AL 1-2, 197-209| PSIPRED cHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHEEccHHHHHcccEEEcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHcccccccccEEEEcc //