[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35492.1
DDBJ      :             diacylglycerol kinase, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  132/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->114 PF01219 * DAGK_prokar 5e-14 37.0 %
:HMM:PFM   12->114 PF01219 * DAGK_prokar 6.2e-32 44.7 103/104  
:BLT:SWISS 3->113 UDPK_STRMU 1e-11 36.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35492.1 GT:GENE AAD35492.1 GT:PRODUCT diacylglycerol kinase, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 425861..426343 GB:FROM 425861 GB:TO 426343 GB:DIRECTION + GB:PRODUCT diacylglycerol kinase, putative GB:NOTE similar to PID:1001103 PID:1001137 percent identity: 58.26; identified by sequence similarity; putative GB:PROTEIN_ID AAD35492.1 GB:DB_XREF GI:4980912 LENGTH 160 SQ:AASEQ MQRDSNNILKSFKNAFEGIENALKLERNLKIHFFIGIVVAIFSLFLPLSANDLLWIYFAIFSVIGAELLNTVVEKFLDLFFKEYSESVKLVKDIAAGVVLWYSLFSVVVGILILGKALFSWEPSFAKFFVSGVLIFFPVISFSMRRYRNDRQGDKSTGSR GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 3->113|UDPK_STRMU|1e-11|36.9|111/137| TM:NTM 3 TM:REGION 38->60| TM:REGION 93->115| TM:REGION 123->144| RP:PFM:NREP 1 RP:PFM:REP 15->114|PF01219|5e-14|37.0|100/104|DAGK_prokar| HM:PFM:NREP 1 HM:PFM:REP 12->114|PF01219|6.2e-32|44.7|103/104|DAGK_prokar| GO:PFM:NREP 3 GO:PFM GO:0004143|"GO:diacylglycerol kinase activity"|PF01219|IPR000829| GO:PFM GO:0008654|"GO:phospholipid biosynthetic process"|PF01219|IPR000829| GO:PFM GO:0016020|"GO:membrane"|PF01219|IPR000829| OP:NHOMO 132 OP:NHOMOORG 132 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1-----------------1--1-1--1-1--------------------------111--------1--11------------------11-1-111-1--1------1------------1------1-----------1-11111-111-111111111111111-------1----1-----11--1-11-1111---1---1111111111111111111111111111--11----1111-11111111-1-11111111---1---------1--1-111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 146-160| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //