[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35497.1
DDBJ      :             alcohol dehydrogenase, zinc-containing
Swiss-Prot:             

Homologs  Archaea  43/68 : Bacteria  697/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
b.35.1c.2.1c.30.1
:395 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->395 3ip1A PDBj 0.0 99.5 %
:RPS:PDB   52->390 2eerB PDBj 2e-38 27.4 %
:RPS:SCOP  1->236 1kolA1  b.35.1.2 * 7e-23 21.2 %
:RPS:SCOP  207->325 1a9xA3  c.30.1.1 * 2e-14 16.1 %
:HMM:SCOP  28->223 1e3jA1 b.35.1.2 * 3.8e-40 37.6 %
:HMM:SCOP  183->358 1ykfA2 c.2.1.1 * 4.4e-36 33.1 %
:RPS:PFM   55->167 PF08240 * ADH_N 1e-19 49.0 %
:RPS:PFM   223->289 PF00107 * ADH_zinc_N 2e-10 48.5 %
:HMM:PFM   53->172 PF08240 * ADH_N 1.5e-32 41.7 108/109  
:HMM:PFM   222->356 PF00107 * ADH_zinc_N 2e-22 31.2 128/130  
:BLT:SWISS 53->373 TDH_THETN 7e-40 36.4 %
:PROS 94->108|PS00059|ADH_ZINC
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35497.1 GT:GENE AAD35497.1 GT:PRODUCT alcohol dehydrogenase, zinc-containing GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 429879..431066 GB:FROM 429879 GB:TO 431066 GB:DIRECTION + GB:PRODUCT alcohol dehydrogenase, zinc-containing GB:NOTE similar to GB:AL009126 percent identity: 54.90; identified by sequence similarity; putative GB:PROTEIN_ID AAD35497.1 GB:DB_XREF GI:4980917 LENGTH 395 SQ:AASEQ MRAVRLHAKWDPRPEFKLGPKDIEGKLTWLGSKVWRYPEVRVEEVPEPRIEKPTEIIIKVKACGICGSDVHMAQTDEEGYILYPGLTGFPVTLGHEFSGVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGFPNHCENLNELGFNVDGAFAEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVAYNAVIVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGADHVIDPTKENFVEAVLDYTNGLGAKLFLEATGVPQLVWPQIEEVIWRARGINATVAIVARADAKIPLTGEVFQVRRAQIVGSQGHSGHGTFPRVISLMASGMDMTKIISKTVSMEEIPEYIKRLQTDKSLVKVTMLNE GT:EXON 1|1-395:0| BL:SWS:NREP 1 BL:SWS:REP 53->373|TDH_THETN|7e-40|36.4|297/347| PROS 94->108|PS00059|ADH_ZINC|PDOC00058| SEG 36->51|rypevrveevpeprie| BL:PDB:NREP 1 BL:PDB:REP 1->395|3ip1A|0.0|99.5|388/389| RP:PDB:NREP 1 RP:PDB:REP 52->390|2eerB|2e-38|27.4|318/347| RP:PFM:NREP 2 RP:PFM:REP 55->167|PF08240|1e-19|49.0|100/108|ADH_N| RP:PFM:REP 223->289|PF00107|2e-10|48.5|66/128|ADH_zinc_N| HM:PFM:NREP 2 HM:PFM:REP 53->172|PF08240|1.5e-32|41.7|108/109|ADH_N| HM:PFM:REP 222->356|PF00107|2e-22|31.2|128/130|ADH_zinc_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00107|IPR013149| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00107|IPR013149| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00107|IPR013149| RP:SCP:NREP 2 RP:SCP:REP 1->236|1kolA1|7e-23|21.2|193/201|b.35.1.2| RP:SCP:REP 207->325|1a9xA3|2e-14|16.1|118/127|c.30.1.1| HM:SCP:REP 28->223|1e3jA1|3.8e-40|37.6|178/0|b.35.1.2|1/1|GroES-like| HM:SCP:REP 183->358|1ykfA2|4.4e-36|33.1|169/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 3923 OP:NHOMOORG 914 OP:PATTERN 221-2-47BAABACC7142313--8--23351------------2---1-211-1112111222--25 66C-6113445-1136633-3E11AI444446EDCE7GKB2446A573242297B53311227582D9D752111131---18112111122-2-----2-3-2-8-222--------------1-1----1----25532111274337221-----------124978-------------44333441629222222342332232C65574223532282244444333233333333433334334441-4--3-6--144441-3123373233221222311333323334342222222221222322111222222-16332333323274--1-1-1-21-111--212141221222221-34355223-----6388B4-38744533323333335-75547756475-CBB6EC9CC9AF661114265467523222222224433-112-------------------------------721111112AAACAA98688889E9999278994846--22723233543153211-1--2-212112121421-2311--1--11----33313122133535B34----------1--------------23111124316211111121232212121111---21--------2353225A77AAAAA99-79A9A99989799AAAAA56543533184A597B88BA68658653566461-233333333333---2111113222--2961113-2-111--23-334441412-6-64562632334334222111111111-1111111-11211122433322222111--12221111--------1--------31--1-------21-----1311124333132 ----4-1-2----13GLIHHCMDQNMH7745565555746445654AA9ACDSOBEA5745524C15224256376754614444753-DKAL694GBB8686637-212D112121111-151221814F3-6131--11-1312211-11-211133225-361423682221243-7---226697H8831NEEB- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 395 STR:RPRED 100.0 SQ:SECSTR EEEEEEEETTEEEEEEEcccccEETTccccGGGTEEEEEEEEEEEccTTEEcTTcEEEEEEEEEEcTHHHHHHHTEETTEETTTTTccccEEcccEEEEEEEEEcTTcccccTcccccTTcEEEEccEEcccccHHHHTTcGGGccccEEcTTTcccccccEEEEccGGGEEEccccHHcccccHHHHGGGGTHHHHHHHHHHHHHTTccTTcEEEEETTcHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHTTccEEEETTTccHHHHHHHHTTTccEEEEEEccccHHHHTTGGGGEEEEEETTEEEEEEcccccccccccHHHHHHHTcEEEEccccccHHHHHHHHHHHHTTccccccEEEEEEGGGHHHHHHHHHTTccccEEEEccc DISOP:02AL 1-9| PSIPRED cccEEEEEEccccccccccccHHHHHHHHHccEEEcccEEEEEEEcccccccccEEEEEEEEEEEccccEEEEEccccccccccccccccEEEcccEEEEEEEEcccccccccccccccccEEEEcccccccccHHHHcccccccccccEEEEcccccEEEEEEEcHHHEEEccccccccHHHHHHHHHHHHHHHHHHHEEEEEEccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEccccccHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHcccccEEEEEEEEccccccEEccHHHHHEEEEEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHccccEEEEEEEEc //