[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35561.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:417 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35561.1 GT:GENE AAD35561.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(502814..504067) GB:FROM 502814 GB:TO 504067 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35561.1 GB:DB_XREF GI:4980986 LENGTH 417 SQ:AASEQ MKKLLALFLVLGLLVTAAFAYEDVVKVNVSGTGYFNAYLDEEGIDLEGGISDLSVSISPSSGSVTAPATITAEFSIDVLGTDASLSKIAVTTDLFDLTYYNSDIYGDGYVFYYVGDRALEFTPKLGLEGISLTAYFADIVSETDLTNATNDTNNYFDDAVALKLGVTNLDLLDATLFGAFYDTDTNNATSAYGYAAHLNLTGKDILENLVVDLAYAYEATSMYLVEAQYSKSFEMEPVTLTVSPYFVYSEGAPTYYDDDSVDGDGWTAPWGSKLVKVGLKAEAGVTDEVTFSAELTPTYDLDANSFSLPVTLALAYDSDMAEANVSASWDDAVASATNVTIDANLTVTAVENLTVKAAAQYKVATNELGYNVDTSYVYGPLTTGFFFGTLFDSNSDGTADINDYFTWYLYLKASVAF GT:EXON 1|1-417:0| TM:NTM 1 TM:REGION 4->26| SEG 4->20|llalflvlgllvtaafa| SEG 51->63|sdlsvsispssgs| SEG 105->116|ygdgyvfyyvgd| SEG 143->154|tdltnatndtnn| SEG 323->336|anvsaswddavasa| SEG 381->391|lttgfffgtlf| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEEEccccccccccccEEEEEEEcccccEEccEEEEEEEEEEEEEccccccEEEEEEEEEEEEEEccccccccEEEEEEccEEEEEccccccccEEHHHHHHHHHccccccccccccccccccEEEEEEcccccHHHHHHHEEEEEEccccccccccEEEEEEEccHHHHHHHHHHHHHHHccccEEEEEEEEccccccccEEEEEEEEEEEEEccccccccccccccccccccccccEEEEEccccccccccEEEEEEccEEEEcccccEEcEEEEEEEEccccccccccccccHHHcccEEEEEEccEEEEEEEcEEEEEEEEEEEEHHHccccccccEEEccccccEEEEEEEEcccccccccHHHEEEEEEEEEEEcc //