[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35566.1
DDBJ      :             tyrosyl-tRNA synthetase
Swiss-Prot:SYY_THEMA    RecName: Full=Tyrosyl-tRNA synthetase;         EC=6.1.1.1;AltName: Full=Tyrosine--tRNA ligase;         Short=TyrRS;

Homologs  Archaea  45/68 : Bacteria  906/915 : Eukaryota  170/199 : Viruses  0/175   --->[See Alignment]
c.26.1d.66.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->393 1h3eA PDBj 1e-98 51.5 %
:RPS:PDB   1->318 2cyaA PDBj 1e-63 22.5 %
:RPS:PDB   339->392 2cqjA PDBj 1e-04 22.2 %
:RPS:SCOP  11->309 1jiiA  c.26.1.1 * e-101 30.8 %
:RPS:SCOP  299->393 1jh3A  d.66.1.4 * 1e-11 28.4 %
:HMM:SCOP  2->316 1jilA_ c.26.1.1 * 1e-91 39.9 %
:HMM:SCOP  297->393 1jh3A_ d.66.1.4 * 3e-21 38.9 %
:RPS:PFM   33->260 PF00579 * tRNA-synt_1b 2e-32 39.6 %
:RPS:PFM   339->377 PF01479 * S4 4e-05 41.0 %
:HMM:PFM   29->317 PF00579 * tRNA-synt_1b 1.3e-76 35.3 283/292  
:HMM:PFM   337->378 PF01479 * S4 2.3e-13 35.7 42/48  
:BLT:SWISS 1->401 SYY_THEMA 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35566.1 GT:GENE AAD35566.1 GT:PRODUCT tyrosyl-tRNA synthetase GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(505387..506592) GB:FROM 505387 GB:TO 506592 GB:DIRECTION - GB:PRODUCT tyrosyl-tRNA synthetase GB:NOTE similar to GB:AE000657 percent identity: 76.90; identified by sequence similarity; putative GB:PROTEIN_ID AAD35566.1 GB:DB_XREF GI:4980991 LENGTH 401 SQ:AASEQ MTPEEQVKILKRNVVDLISEEELLDRIKRKGKLRVKLGVDPSRPDLHLGHAVVLRKLREFQDLGHTVVLIIGDFTARIGDPSGRNETRPMLTKEEVLENAKTYQEQAFKILDPKRTELRFNGEWLDRMTFADVIILASKYTVARMLERDDFAKRFKEGIPIAISEFLYPLAQAYDSVAIQSDVELGGTDQLFNLLVGRKIQEEYGQEPQIVMTMPIIEGTDGKLKMSKSYGNYIAFNDPPEEMYGKLMSIPDELIIKYMRLLTDIPEERIEEYERKMKEKTINPRDVKMVLAYEITRFFHGEENAKKAQEHFVKVFQKKEIPDEMPVVEISQEKNIVDLLVEIGAASSKSEAKRLVSQGGVYIDGERIEDIKFTVEPDGERVLRVGKRKFYRISGGETKKL GT:EXON 1|1-401:0| SW:ID SYY_THEMA SW:DE RecName: Full=Tyrosyl-tRNA synthetase; EC=6.1.1.1;AltName: Full=Tyrosine--tRNA ligase; Short=TyrRS; SW:GN Name=tyrS; OrderedLocusNames=TM_0478; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->401|SYY_THEMA|0.0|100.0|401/401| GO:SWS:NREP 7 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| BL:PDB:NREP 1 BL:PDB:REP 2->393|1h3eA|1e-98|51.5|390/427| RP:PDB:NREP 2 RP:PDB:REP 1->318|2cyaA|1e-63|22.5|306/328| RP:PDB:REP 339->392|2cqjA|1e-04|22.2|54/71| RP:PFM:NREP 2 RP:PFM:REP 33->260|PF00579|2e-32|39.6|217/279|tRNA-synt_1b| RP:PFM:REP 339->377|PF01479|4e-05|41.0|39/46|S4| HM:PFM:NREP 2 HM:PFM:REP 29->317|PF00579|1.3e-76|35.3|283/292|tRNA-synt_1b| HM:PFM:REP 337->378|PF01479|2.3e-13|35.7|42/48|S4| GO:PFM:NREP 7 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00579|IPR002305| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00579|IPR002305| GO:PFM GO:0005524|"GO:ATP binding"|PF00579|IPR002305| GO:PFM GO:0005737|"GO:cytoplasm"|PF00579|IPR002305| GO:PFM GO:0006412|"GO:translation"|PF00579|IPR002305| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00579|IPR002305| GO:PFM GO:0003723|"GO:RNA binding"|PF01479|IPR002942| RP:SCP:NREP 2 RP:SCP:REP 11->309|1jiiA|e-101|30.8|295/319|c.26.1.1| RP:SCP:REP 299->393|1jh3A|1e-11|28.4|88/99|d.66.1.4| HM:SCP:REP 2->316|1jilA_|1e-91|39.9|311/323|c.26.1.1|1/1|Nucleotidylyl transferase| HM:SCP:REP 297->393|1jh3A_|3e-21|38.9|90/99|d.66.1.4|1/1|Alpha-L RNA-binding motif| OP:NHOMO 1228 OP:NHOMOORG 1121 OP:PATTERN --1-11111111111---1111111--1111-111111111111-111111111----------1--- 1111111111111111111-11111111111111111111111111211111111111111111111111111111111111111111222111111111121112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122222222122222211221222211121111111111111111111111111111111312111111111111111111111111111111111111111111111111111111111111221111111122222222222211221111211111211122111111211111111111111111111111111111111111111111111-111111111111111111121111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111112111111111111111111111-111111111111111111111111-111-11111111111111111111111222111111111111111111111111111111111111111111111111111111111111111111-11111111111111111222211111111111111111111111111122222221221111111-11111111111111111111111111111111-11111111111111111111111111111211 ----111-1-----111111111111111111111111-21111-11111111111111111211111-1111111112111111111--1-1111111111-112-1-1211111-11--1111111-151-11111111111-111--1114-11111211211-111611221111A1111111121111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 393 STR:RPRED 98.0 SQ:SECSTR cHHHHHHHHHHTTccEEETHHHHHHHHHHccccEEEEEEccccccccTHHHHHHHHHHHHHHTTcEEEEEEcHHHHHHTTGGGGcHHHHHHHHHHHHHHHHHTTccGGGcEEEEHHHHHTcHHHHHHHcHHHHHHHHHTccHHHHHcHHHHHTTcccGGGccTHHHHHHHHHHHHHHHTTccEEEEEGGGHHHHHHHHHHHTTTTccccEEEEEccccccccccccccccGGGcccTTccHHccTccTTcHHHHHHHHccEEcccEEccHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHccHHHHHHHHHHHHHHHHHTccTTTTcccccHHHHHHHHTTcEEETTEEcccTTccccTTEEEEEcccTTccHHH######## DISOP:02AL 219-232, 399-401| PSIPRED ccHHHHHHHHHcccEEEcccHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEEccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHcccccEEEEEccEEEccccccccccccccEEEccccHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHccEEEEcccccHHHHHHHcccccccHHHHHHHHcccEEEccEEEcccccEEccccEEEEEEcccEEEEEEEcccccc //