[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35587.1
DDBJ      :             oligopeptide ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  782/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:313 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  97->307 2r6gG1  f.58.1.1 * 3e-18 11.2 %
:HMM:PFM   126->312 PF00528 * BPD_transp_1 2.1e-33 29.5 173/185  
:HMM:PFM   18->39 PF12159 * DUF3593 0.00034 45.5 22/93  
:BLT:SWISS 97->310 APPC_BACSU 5e-47 39.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35587.1 GT:GENE AAD35587.1 GT:PRODUCT oligopeptide ABC transporter, permease protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(529569..530510) GB:FROM 529569 GB:TO 530510 GB:DIRECTION - GB:PRODUCT oligopeptide ABC transporter, permease protein GB:NOTE similar to SP:P42063 PID:677947 GB:AL009126 percent identity: 63.90; identified by sequence similarity; putative GB:PROTEIN_ID AAD35587.1 GB:DB_XREF GI:4981013 LENGTH 313 SQ:AASEQ MNQEFKRIMKRFFRDPSAIIGFSLVLFFVVIAILAPVIAPPIHPLTRAKLPDPYLMPVVSWNQSPQPPTTKEDALAKNPNREPIRCVDYHPFGVIGGRDILYGIVWGTRTAFKIGLIVTLARLLIGVFIGSISGYFGGWIDEVLMRITDIFLSIPFLIAAVVLTTVLGTGLDKVMIAMIVFGWMGAARLIRGNILQVREEQFVLAAKAIGVPDFLIILKHVLPNTIFPVLIWASMNMGSLVITAAVLSFLGLGAPQGYADWGSILSYSRDWMMEIGKHWYALVYPGTAMVLFVLGWNLLGDALRDAFDPRLKF GT:EXON 1|1-313:0| BL:SWS:NREP 1 BL:SWS:REP 97->310|APPC_BACSU|5e-47|39.0|213/303| TM:NTM 6 TM:REGION 18->40| TM:REGION 114->136| TM:REGION 154->176| TM:REGION 207->229| TM:REGION 239->261| TM:REGION 280->302| SEG 29->42|vviailapviappi| HM:PFM:NREP 2 HM:PFM:REP 126->312|PF00528|2.1e-33|29.5|173/185|BPD_transp_1| HM:PFM:REP 18->39|PF12159|0.00034|45.5|22/93|DUF3593| RP:SCP:NREP 1 RP:SCP:REP 97->307|2r6gG1|3e-18|11.2|206/284|f.58.1.1| OP:NHOMO 3556 OP:NHOMOORG 844 OP:PATTERN 4441313244444443433332113336435212---1-----113-52-EB5-54433133314-11 1114D453344-4123322-2211292222224333287919486DB436638A732611552395777A44333844323-311111--------2--------11--122222222222222211211212122577952216933223331222111-1132215322111111111111A5434871423666664564546445A76673655324C521222222H6155555555655556333222222331-12111--33111112234333333311112211111112222222222222231123211112C36344434541422222111153153B-211CA631-283-3363174311----1121142HHQ114854B1AAAAA998AAL-44C43A2DQO1-kRRXIIEXULOPK4-115BDA6AA6CC1111111113322319-------------------------------11-1CFCBC57777544555559955552566D64A7113342353353D5CS251132242-------111211346132352233331111111211----14111-1--------12212221113-12--553121111151111111111111111111--13311------77LD3977777777777-7777777777777777776BCBCA3355555555555545455977667574-555555554555---11-1-1111111746222-1223322312322222121234233233658265442ABA1----1---256665555556688--1-------------12111122111111117-111211-1111-2-111111-2111143765BEB88212 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------1--1---1-------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHcccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //