[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35596.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  400/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.18.1
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->191 1l9gA PDBj e-110 100.0 %
:RPS:PDB   21->189 2c2qA PDBj 3e-38 12.7 %
:RPS:SCOP  1->191 1l9gA  c.18.1.2 * 5e-54 100.0 %
:HMM:SCOP  1->191 1l9gA_ c.18.1.2 * 4e-64 50.8 %
:RPS:PFM   35->169 PF03167 * UDG 5e-15 38.4 %
:HMM:PFM   33->180 PF03167 * UDG 4.2e-47 48.6 142/150  
:BLT:SWISS 33->189 DPOL_BPSP1 3e-14 32.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35596.1 GT:GENE AAD35596.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(537550..538128) GB:FROM 537550 GB:TO 538128 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:AE000657 percent identity: 66.13; identified by sequence similarity; putative GB:PROTEIN_ID AAD35596.1 GB:DB_XREF GI:4981023 LENGTH 192 SQ:AASEQ MYTREELMEIVSERVKKCTACPLHLNRTNVVVGEGNLDTRIVFVGEGPGEEEDKTGRPFVGRAGMLLTELLRESGIRREDVYICNVVKCRPPNNRTPTPEEQAACGHFLLAQIEIINPDVIVALGATALSFFVDGKKVSITKVRGNPIDWLGGKKVIPTFHPSYLLRNRSNELRRIVLEDIEKAKSFIKKEG GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 33->189|DPOL_BPSP1|3e-14|32.9|152/924| BL:PDB:NREP 1 BL:PDB:REP 1->191|1l9gA|e-110|100.0|191/191| RP:PDB:NREP 1 RP:PDB:REP 21->189|2c2qA|3e-38|12.7|165/183| RP:PFM:NREP 1 RP:PFM:REP 35->169|PF03167|5e-15|38.4|125/147|UDG| HM:PFM:NREP 1 HM:PFM:REP 33->180|PF03167|4.2e-47|48.6|142/150|UDG| RP:SCP:NREP 1 RP:SCP:REP 1->191|1l9gA|5e-54|100.0|191/191|c.18.1.2| HM:SCP:REP 1->191|1l9gA_|4e-64|50.8|191/191|c.18.1.2|1/1|Uracil-DNA glycosylase-like| OP:NHOMO 616 OP:NHOMOORG 452 OP:PATTERN 11111111111111121121122131121222--------------1-11111-11121112-11111 12311----------11--------1-----113131-11211-1-----------------1--1--1---------1111311111--------------------1----------------11-1111111111122111111-11---1111111111--111111111111111111-1122111---1111111111111111-----111-----------------------------------11------111--11-------------------------------------------------------1--2-2222222-2-3-222----22--1---2111111111111111-1112122211111222221222121211111111112-223221223211122233234322311111222222211222222221223212111111111111111111111111111111111--1111122221222111122332222111232221--11111------11-11121-111-------112221-1-111----------1-1111213323221211111---------------1121121---------------------------------2111--------------------------------------------------------------------------------------------------11112------------------------------------------------------------------------1-12122111------11--1111--------11--------------------------1111111111132 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 99.5 SQ:SECSTR ccccHHHHHHHcHHTTTTcGccTTTTTTccccccccTTccEEEEEccccHHHHHHTcccccTTccHHHHHHHHTTccccTEEEEEccccccccGGGccGGGHHccHHHHHHHHHHHcccEEEEccHHHHHHHHHcccGGGcccEEccccccTTcEEEEcccccGGGTTTccHHHHHHHHHHHHHHHHHHTc# DISOP:02AL 190-192| PSIPRED cccHHHHHHHHHHHHHHcccccccccccccEEccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHHccccccHHHHccEEEEcccccEEEEEEccHHHHccccHHHHHHHHHHHHHHHHHHHHcc //