[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35626.1
DDBJ      :             fumarate hydratase, C-terminal subunit
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  475/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
c.8.9
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->163 1vpjA PDBj 4e-15 36.8 %
:RPS:SCOP  3->163 2isbA1  c.8.9.1 * 1e-47 36.9 %
:HMM:SCOP  2->163 2isbA1 c.8.9.1 * 2.8e-49 49.7 %
:RPS:PFM   3->164 PF05683 * Fumerase_C 2e-41 53.7 %
:HMM:PFM   3->164 PF05683 * Fumerase_C 1.7e-59 50.6 162/206  
:BLT:SWISS 15->164 FUMB_ECOLI 2e-32 42.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35626.1 GT:GENE AAD35626.1 GT:PRODUCT fumarate hydratase, C-terminal subunit GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 566734..567228 GB:FROM 566734 GB:TO 567228 GB:DIRECTION + GB:PRODUCT fumarate hydratase, C-terminal subunit GB:NOTE similar to GB:AE000657 percent identity: 67.28; identified by sequence similarity; putative GB:PROTEIN_ID AAD35626.1 GB:DB_XREF GI:4981055 LENGTH 164 SQ:AASEQ MRIEDLKAGQEIRYSGKLIVMRDQAQRRLKEIVDRGEEPPVDLRGQIVFYAGPAKTPSGKPVGAIGPTTSARMDDYLEMLFKLGAIATIGKGKRSKKAIEACKKWKRVYFVTPSGTAAALSKRVKKSRVLAFEDLGPEAIYEIEVEDFPLIVAIDSNGNTIFKE GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 15->164|FUMB_ECOLI|2e-32|42.7|150/548| BL:PDB:NREP 1 BL:PDB:REP 2->163|1vpjA|4e-15|36.8|155/170| RP:PFM:NREP 1 RP:PFM:REP 3->164|PF05683|2e-41|53.7|162/184|Fumerase_C| HM:PFM:NREP 1 HM:PFM:REP 3->164|PF05683|1.7e-59|50.6|162/206|Fumerase_C| GO:PFM:NREP 1 GO:PFM GO:0016836|"GO:hydro-lyase activity"|PF05683|IPR004647| RP:SCP:NREP 1 RP:SCP:REP 3->163|2isbA1|1e-47|36.9|160/178|c.8.9.1| HM:SCP:REP 2->163|2isbA1|2.8e-49|49.7|161/0|c.8.9.1|1/1|FumA C-terminal domain-like| OP:NHOMO 711 OP:NHOMOORG 540 OP:PATTERN ---1-11----------1111111--------211111111111111111111111111-----1--- -11-11-------------------1----------1121--------------------111-111111----------1211-11111111111-----1----1------------------11111-111-------111--------------------------------------------11111-111111111111111-1----1111111---------1--------------------------------11---------------------------------------------------------11-11111111111111111---111--21212111111112111111--11----------11111--11111111111111111-------1111--1--1111112---1---1-1------111111111111-12-1------------------------------11111122-31111111111111121111-111112121111111111111111211-11111-111111---1111111111212111111111111-111111111121-1-------1--------2111--112111111111111111111121111211----1--------41111213443333333-433343334343433333433311---433343443443433413123333--211111111111---1----------1111---------------1111111---2111111111111121111111111111-1111111111111111111111111111111111------------1---------------------------111--12111-11 11----1-422--1---------------------------------------------------------------------------------------------1112-----------------------------------------------1---111---------1-1118111---------112---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 94.5 SQ:SECSTR #HHHHccTTcEEEEEEEEEEccHHHHHHHHHH#HHTcccccccTTcEEEccccEEcccEEEEEc#ccccGGGTTTHHHHHHHccc#EEEEccc#cHHHHHHTTTEEEEEcccccTTGGGGEEEEEE###EEcGGGcTTcEEEEEEEEEEEEEEEcTTcccTTc# DISOP:02AL 162-164| PSIPRED ccccccccccEEEEccEEEEEHHHHHHHHHHHHHccccccccccccEEEEEccccccccEEEEEEcccccccccHHHHHHHHcccEEEEEEccccHHHHHHHHHccEEEEEccccHHHHHHHHHHHHEEEcccccccccEEEEEEEccEEEEEEEcccccHHcc //