[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35628.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:412 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->191 3cniA PDBj 3e-60 100.0 %
:RPS:PFM   215->356 PF01061 * ABC2_membrane 5e-04 32.5 %
:BLT:SWISS 217->272 YCBO_BACSU 9e-04 30.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35628.1 GT:GENE AAD35628.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(568356..569594) GB:FROM 568356 GB:TO 569594 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 59.61; identified by sequence similarity; putative GB:PROTEIN_ID AAD35628.1 GB:DB_XREF GI:4981057 LENGTH 412 SQ:AASEQ MFGKLLKKEIKELLNLGAIVSVIVVAVLYGSLGNVFKSTVEKSTVGQKVAIVREDTGTIAELAEKALGNMVDIVYAGSDLKEAEEAVKKEKAPAIIVIPKGFSQSLESGEKARLEIVWYLRGTGLSEAVSTGTISSLIESLKVQLASFLLNDPKKAQLLFDPLEIVQHTYLRGSLFKNHSPEAIMNVFYSQNIMIPILIMMLIIMSGSSLISSLAMEKENKTLETLLTMPVKREHIALAKIVGSAIVGLILAGIYMAGFYSYLNSLTQNVQGMGLNFKAVDFLLMGSSLFLSILAGLSLCMLLGMMAKDYRSAQLLTFPISILALVPMIANMIMDFSNLPGVLKVIVFLIPFSHPIMSPKLAFYGDYGLIVSGILYLLIFSIVTTVFVFRIFNSDYVVLGWQREKRLKFFSR GT:EXON 1|1-412:0| BL:SWS:NREP 1 BL:SWS:REP 217->272|YCBO_BACSU|9e-04|30.4|56/100| TM:NTM 7 TM:REGION 10->32| TM:REGION 193->215| TM:REGION 236->258| TM:REGION 283->305| TM:REGION 313->335| TM:REGION 340->361| TM:REGION 370->392| SEG 4->14|kllkkeikell| SEG 81->100|keaeeavkkekapaiivipk| SEG 193->214|imipilimmliimsgsslissl| BL:PDB:NREP 1 BL:PDB:REP 47->191|3cniA|3e-60|100.0|143/143| RP:PFM:NREP 1 RP:PFM:REP 215->356|PF01061|5e-04|32.5|126/208|ABC2_membrane| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01061|IPR013525| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN ---11------------------------1------------------------1111111------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------1111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 34.7 SQ:SECSTR ##############################################cEEEEEEccccHHHHHHHHHHHT#cEEEEEEccHHHHHHHHHHHTccEEEEEcTTHHHHHHHTccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHTTGGGGccccTTcGGGTccEEEEEEEEETTEEETTccHHHH#HHHTTc############################################################################################################################################################################################################################# DISOP:02AL 76-88| PSIPRED ccEEEEHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHccEEEEEEccccccHHHHHHHHHcccccccccccHHHHHHHHHcccEEEEEEccccHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccEEEEEEEEEcccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //