[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35675.1
DDBJ      :             penicillin-binding protein 2
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  864/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.175.1e.3.1
:557 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   134->548 1mwxB PDBj 1e-35 31.7 %
:RPS:PDB   18->550 3dwkB PDBj 3e-65 13.1 %
:RPS:SCOP  40->189 1mwrA2  d.175.1.1 * 4e-22 23.3 %
:RPS:SCOP  190->541 1mwrA3  e.3.1.1 * 1e-76 27.9 %
:HMM:SCOP  38->189 1vqqA2 d.175.1.1 * 2.4e-24 31.6 %
:HMM:SCOP  190->551 1vqqA3 e.3.1.1 * 1.8e-95 41.0 %
:RPS:PFM   45->169 PF03717 * PBP_dimer 1e-05 39.2 %
:RPS:PFM   210->535 PF00905 * Transpeptidase 6e-46 44.1 %
:RPS:PFM   511->545 PF01640 * Peptidase_C10 6e-04 45.7 %
:HMM:PFM   209->537 PF00905 * Transpeptidase 1.3e-73 43.3 289/304  
:HMM:PFM   45->174 PF03717 * PBP_dimer 8.8e-17 36.2 130/177  
:BLT:SWISS 16->537 PBP2_ECOLI 1e-68 33.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35675.1 GT:GENE AAD35675.1 GT:PRODUCT penicillin-binding protein 2 GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 624073..625746 GB:FROM 624073 GB:TO 625746 GB:DIRECTION + GB:PRODUCT penicillin-binding protein 2 GB:NOTE similar to GB:AE000657 percent identity: 55.31; identified by sequence similarity; putative GB:PROTEIN_ID AAD35675.1 GB:DB_XREF GI:4981109 LENGTH 557 SQ:AASEQ MKNRLILILMALSFVLIIMKAFQVQILEHEKHKKYIDLLQTRLVKIPAPRGKIISSDGKVLAKDEVVYVLDPWLNSIDELKKTGLFTPEEILSLVKGESIVIDKARADVISKAGMRVVMDYRRKYEPLAPHVVGYVNADRAGVYGVESVYDEFLTGTDGVKMVFVEPSGAISSEVLRSPPKPGEDVTLTIDTRIQKVAEESLEKIGNPGSVILSDVRTGEILALASFPEYNPQDFYEGFTKREWERFARNSPSPLINRAISSAYSPGSSIKILWAVAALLNGVDPEEKINCRGVFEYRNSRGEVVARYRDWKEEGHGFTDLRKAIRVSCNVYFYQLGLKLGVDKMVEVAKKLSIFEKTGIDLPGEKSGTLPSPEWKMSKIGEPWYPGDTILMSIGQGYLTATPIELLKLVSLVANEGIFYRPHVVKRIGSKAVKPEIETQVQIDEKIWNFIKDAMVDVTSFKGNEKEDPGTAYHVFGDFPYRVAGKTGTAEAGSGAPHSWFVGFAPAENPEVAIVVMVEHGGYGSGAASQIARRVLEEYFKLKESAQETPVSSRSRD GT:EXON 1|1-557:0| BL:SWS:NREP 1 BL:SWS:REP 16->537|PBP2_ECOLI|1e-68|33.5|508/633| TM:NTM 1 TM:REGION 4->26| BL:PDB:NREP 1 BL:PDB:REP 134->548|1mwxB|1e-35|31.7|378/625| RP:PDB:NREP 1 RP:PDB:REP 18->550|3dwkB|3e-65|13.1|473/621| RP:PFM:NREP 3 RP:PFM:REP 45->169|PF03717|1e-05|39.2|125/188|PBP_dimer| RP:PFM:REP 210->535|PF00905|6e-46|44.1|272/289|Transpeptidase| RP:PFM:REP 511->545|PF01640|6e-04|45.7|35/309|Peptidase_C10| HM:PFM:NREP 2 HM:PFM:REP 209->537|PF00905|1.3e-73|43.3|289/304|Transpeptidase| HM:PFM:REP 45->174|PF03717|8.8e-17|36.2|130/177|PBP_dimer| GO:PFM:NREP 5 GO:PFM GO:0008658|"GO:penicillin binding"|PF03717|IPR005311| GO:PFM GO:0008658|"GO:penicillin binding"|PF00905|IPR001460| GO:PFM GO:0009273|"GO:peptidoglycan-based cell wall biogenesis"|PF00905|IPR001460| GO:PFM GO:0006508|"GO:proteolysis"|PF01640|IPR000200| GO:PFM GO:0008234|"GO:cysteine-type peptidase activity"|PF01640|IPR000200| RP:SCP:NREP 2 RP:SCP:REP 40->189|1mwrA2|4e-22|23.3|150/188|d.175.1.1| RP:SCP:REP 190->541|1mwrA3|1e-76|27.9|315/330|e.3.1.1| HM:SCP:REP 38->189|1vqqA2|2.4e-24|31.6|152/0|d.175.1.1|1/1|Penicillin binding protein dimerisation domain| HM:SCP:REP 190->551|1vqqA3|1.8e-95|41.0|329/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| OP:NHOMO 2105 OP:NHOMOORG 869 OP:PATTERN -------------------------------------------------------------------- 3363322233342322233-33332333333223333444344422332222353223222332223566322222223333321222222222222--222222222221222222122222212222222222233344---3422323322322222222212222332222222222222-11142254688A8AACA4BBABBB456665AB964534213333337533333232233332322332311122112-2112233221122222111122221111111-11111111111111111121122211112449644444445454366366644423444234444443233555322222-31111-1111111111111-1111111111111-11111111-121122211111122111222222222222222222224222121222--------222222222222222212112212222222333333344443333444423333222322222222222222222222222221111111222222222222222222222222232322333343222222122222211111111112211442222222222222222222222222222221-2122211-11142224332222222222-22322222222222222224442322244444444444343444222222222322222222222222222222222222222222222222222222222222222222333333332333323331111111112232322222323322322222222222221222222222222122222--------------------------2222122222232 ------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------12--1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 539 STR:RPRED 96.8 SQ:SECSTR #################HHHTTTTcTTccccccccccHHHHHHHHTcccccccHHHHHHHHHHHHHHHHHHHHHHHccccTTcccHHHHHHHHTccccTTccHHHHHHHHHHHHHHTTcccHHHHHTTcccGGGcccccTTTTccccccccGGGHHHHHHHHHHHTTcGGGccccHHHHTTcccEEEEcccHHHHHHHHHHHHHcTEEEEEEEEETTTccEEEEEccTTccTTTcccTTccEEEEccTTTTccTccccTTTccEEcGGGGHHHHTHHHHHccccTTcEEEcccccccccccTTcccccccTTcccccEEEHHHHHHTTcHHHHHHHHHHHHHHccTTHHHHHHHHTTccccccccHHHHTTTccHHHHHTTccccccccTTGHTTcTTcEEcHHHHHHHHHHHTTTcEEEccccEEEEccEEEccccEEEccccHHHHHHHHHHHHTTccTcccccHcTTcTTTTccccccccEEEEEEEEccTccTTEEEEEEEEEEcccEEEEEEEEEHHHHHTHHHHHHHHHHHHHcccccccccccHHHHTH# DISOP:02AL 543-557| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHEEEEcHHHHHHHHccEEEEEEEcccccEEEEEccEEEEEEEEEEEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEccccccHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHcccccccEEEEEEcHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEccccccccccccccHHHHHHHccccccHHHcHHHHccccccHHHHHHHHHHHHHcccccccEEEcccEEEEcccccccccccccccccccccccHHHHHHHHccHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHcccEEEccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEcccccEEEEEEEccEEccccccEEEEEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccccc //