[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35678.1
DDBJ      :             amino acid ABC transporter, periplasmic amino acid-binding protein
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  748/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->246 2q2cA PDBj 8e-34 38.5 %
:RPS:PDB   30->244 3delB PDBj 2e-48 30.4 %
:RPS:SCOP  30->246 1ii5A  c.94.1.1 * 3e-51 25.1 %
:HMM:SCOP  1->246 2a5sA1 c.94.1.1 * 7.4e-77 52.2 %
:RPS:PFM   31->244 PF00497 * SBP_bac_3 8e-43 46.0 %
:HMM:PFM   31->245 PF00497 * SBP_bac_3 4.9e-76 48.4 215/225  
:BLT:SWISS 30->245 ARTP_BACSU 5e-37 41.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35678.1 GT:GENE AAD35678.1 GT:PRODUCT amino acid ABC transporter, periplasmic amino acid-binding protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(627081..627821) GB:FROM 627081 GB:TO 627821 GB:DIRECTION - GB:PRODUCT amino acid ABC transporter, periplasmic amino acid-binding protein GB:NOTE similar to GB:AE000782 percent identity: 64.68; identified by sequence similarity; putative GB:PROTEIN_ID AAD35678.1 GB:DB_XREF GI:4981112 LENGTH 246 SQ:AASEQ MKKLLAVSILLVSIVIFSGAIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVAVQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYGIAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFSE GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 30->245|ARTP_BACSU|5e-37|41.5|212/255| TM:NTM 1 TM:REGION 9->31| SEG 4->18|llavsillvsivifs| BL:PDB:NREP 1 BL:PDB:REP 30->246|2q2cA|8e-34|38.5|213/231| RP:PDB:NREP 1 RP:PDB:REP 30->244|3delB|2e-48|30.4|214/232| RP:PFM:NREP 1 RP:PFM:REP 31->244|PF00497|8e-43|46.0|213/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 31->245|PF00497|4.9e-76|48.4|215/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 30->246|1ii5A|3e-51|25.1|211/222|c.94.1.1| HM:SCP:REP 1->246|2a5sA1|7.4e-77|52.2|245/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 4085 OP:NHOMOORG 788 OP:PATTERN 11---1----------1-2222212--11-1111----7599312114-11-1----1------1--- ----432322224232211-18112D111111A88836CC14334142322-656223--112-7666492644454421321-----221--1----------1----111111111111111-1---1-16-1-222441113-34585563233-1-11-14114461--11----11--4441133--263444447544554453332674453225544444443A42222222222222222222256479887556666688364684222555655537766677776667555445555555539898888872455B44355552324433233323221333317715121-2111122281--11114322333K79332422325665537767N-11C11A1B7E21UMMIIGHMJMGJH8---13A54562451111111132311225----------111111111111111--1-2-----7CAACOQQRRPA9AA9JJKTBBBB8BQIX7CA7--CCD44954F6DAHG126--11853322222---14-17D2777B4BC99946168-521132-31--516447444443222222222132----776-3121--912111123111142341522-5-1-1------99HG8BA7887886888-889888878888878777AHLFHG663C8798A9999A99998E777978741A89999998999--3-111116666--47B33363522222222144444-53652-EEDFCMJR9AC993DDD---------1454955555666551-1-1-----------47111122--------2131-2----------------------131-124212-11 --------------------------------------------------------1-----------------------------------------------------------------------------------------------------1----1------1--1-----------1--11--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 92.7 SQ:SECSTR ##################cEEcccTTcEEEEEEEccccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEcccccccccGGGcccEEEETTcHHHHHHHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHTTcc DISOP:02AL 246-247| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHHcccEEEccEEEEEEcccccccccHHHHcccEEEEEcccHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHcccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //