[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35681.1
DDBJ      :             sugar ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  568/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:420 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   189->382 2r6gF PDBj 6e-14 25.9 %
:RPS:SCOP  177->388 2r6gF2  f.58.1.1 * 3e-21 25.0 %
:HMM:PFM   208->414 PF00528 * BPD_transp_1 1e-21 19.3 181/185  
:HMM:PFM   21->44 PF11014 * DUF2852 0.00089 39.1 23/115  
:BLT:SWISS 1->166 YESP_BACSU 2e-06 26.8 %
:BLT:SWISS 189->388 ARAP_BACHD 2e-38 40.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35681.1 GT:GENE AAD35681.1 GT:PRODUCT sugar ABC transporter, permease protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 630654..631916 GB:FROM 630654 GB:TO 631916 GB:DIRECTION + GB:PRODUCT sugar ABC transporter, permease protein GB:NOTE similar to PID:2337834 percent identity: 61.03; identified by sequence similarity; putative GB:PROTEIN_ID AAD35681.1 GB:DB_XREF GI:4981115 LENGTH 420 SQ:AASEQ MKPSKKLREAVLAYLFLLPSLVVLGMFVFWPVGFSFVLSFFKWDFRNMKNPYFTGLDNYIEIFKFDYPPKYSFVFTVLNTFFHLAVAGAIVMLIVHLIKKRTLSGIISNAAVVLVYIALNLFNVENPILSFLVAAISWSWLVYDFKRVEFKNTWLWFILFLAVFVFVELNSSLPGLVNFLLDAKDKNLFLKALTNTLYYVILSVPSQIFISLMIALLLNSNVKFRVFFRTAYFIPFVTSVVAISLVWKWIFNDEFGLLNYILSLFNIEPISWLKDERWTIPTIAIVSVWKTVGYDAVIFLAGLQNIDRSYYEAAEVDGASSLQKFFYITWPLLSPTTFFLLIVSLIGAFKVFAEVYVLYDGLPGPYNNSGMTLVYYVFDLFYRQQRMGIASAAAYILFAIILIFTFIQYRVGRRAVEYVS GT:EXON 1|1-420:0| BL:SWS:NREP 2 BL:SWS:REP 1->166|YESP_BACSU|2e-06|26.8|158/309| BL:SWS:REP 189->388|ARAP_BACHD|2e-38|40.1|197/316| TM:NTM 9 TM:REGION 15->37| TM:REGION 74->96| TM:REGION 112->134| TM:REGION 156->178| TM:REGION 197->219| TM:REGION 239->261| TM:REGION 281->303| TM:REGION 334->356| TM:REGION 388->410| SEG 389->407|iasaaayilfaiiliftfi| BL:PDB:NREP 1 BL:PDB:REP 189->382|2r6gF|6e-14|25.9|193/490| HM:PFM:NREP 2 HM:PFM:REP 208->414|PF00528|1e-21|19.3|181/185|BPD_transp_1| HM:PFM:REP 21->44|PF11014|0.00089|39.1|23/115|DUF2852| RP:SCP:NREP 1 RP:SCP:REP 177->388|2r6gF2|3e-21|25.0|212/244|f.58.1.1| OP:NHOMO 3211 OP:NHOMOORG 608 OP:PATTERN 33--321134233442811221--81161-4-----------------------3342111432---- ---1i2-3335-1113344-423349444444245414465336M*Z2CHF4QJM11A--868BK3CNWI67444EA71---4-------------------------1---------------------------8AA78---76221311-11222212222221333--2-----2----DD266DF-953222222331132223SI994822354B29457787779*111111111111111-1---531-23--11133--22---1-42342325444422666777766664333344443333355-1-5553G4-3A1111121514D2--1455e-26223D--231--1J--1886I2-1-------111112-DBB1--435536766677777E---6--3-18N--YVVJcXPnjeUR11---8F98668C85--------4112--12-----------------------------2---2-132336887765133344894443336562222--2237-13232668D----1--3--------------1-1--1-----1111---------222223----------1------------------125-----1-5----------------------1---------26771413333333333-33333334333323333325656611123222222222222226-213333--488888888888---------11111-74C111111-----1--1------------22222222311123434-----------222222223154411111111111111-------------------1711111-11-1211111---132---7LFC9AS9DB-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------2--1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 46.0 SQ:SECSTR ############################################################################################################################################################################################HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccTTHHHHHHHTTHHHHccHHHHHHHHHHHTcccccHHHHHHHTccccc#cTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGccTHHHHHHHHTccccHHHHHHTTGGGTHHHHHHHHHHHHHHHHTcHHHHHHHccccccccccccccHHHHHHHHHT###################################### DISOP:02AL 1-6| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcc //