[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35697.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.69.4
:39 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->36 2o9kC PDBj 4e-05 51.5 %
:RPS:PDB   2->38 2ehnB PDBj 5e-07 13.5 %
:RPS:SCOP  3->38 1nr0A2  b.69.4.1 * 1e-06 25.0 %
:HMM:SCOP  1->38 1u4cA_ b.69.4.2 * 8.6e-07 50.0 %
:RPS:PFM   4->36 PF00400 * WD40 7e-04 54.5 %
:HMM:PFM   3->36 PF00400 * WD40 1.2e-11 44.1 34/39  
:BLT:SWISS 2->38 YY46_ANASP 6e-06 51.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35697.1 GT:GENE AAD35697.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 643495..643614 GB:FROM 643495 GB:TO 643614 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35697.1 GB:DB_XREF GI:4981132 LENGTH 39 SQ:AASEQ MIKTLKEHTKIVRSVTFSPNGKYLAVGDICGTVEIWRVL GT:EXON 1|1-39:0| BL:SWS:NREP 1 BL:SWS:REP 2->38|YY46_ANASP|6e-06|51.4|37/1526| BL:PDB:NREP 1 BL:PDB:REP 4->36|2o9kC|4e-05|51.5|33/303| RP:PDB:NREP 1 RP:PDB:REP 2->38|2ehnB|5e-07|13.5|37/285| RP:PFM:NREP 1 RP:PFM:REP 4->36|PF00400|7e-04|54.5|33/39|WD40| HM:PFM:NREP 1 HM:PFM:REP 3->36|PF00400|1.2e-11|44.1|34/39|WD40| RP:SCP:NREP 1 RP:SCP:REP 3->38|1nr0A2|1e-06|25.0|36/299|b.69.4.1| HM:SCP:REP 1->38|1u4cA_|8.6e-07|50.0|38/0|b.69.4.2|1/1|WD40 repeat-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 39 STR:RPRED 100.0 SQ:SECSTR EccTTcccTTcEEEEEETTcTTEEEEEcccccEEEEEcE DISOP:02AL 1-7| PSIPRED ccccHHHHHHHHHHEEEcccccEEEEcccccccEEEEcc //