[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35710.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.76.1
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   43->356 1ei6A PDBj 6e-05 11.5 %
:RPS:SCOP  171->315 1ei6A  c.76.1.4 * 6e-07 16.3 %
:HMM:SCOP  3->375 1ei6A_ c.76.1.4 * 8.9e-25 24.0 %
:RPS:PFM   182->236 PF01663 * Phosphodiest 9e-07 40.0 %
:HMM:PFM   153->241 PF01663 * Phosphodiest 4e-13 31.5 89/364  
:HMM:PFM   127->170 PF04099 * Sybindin 0.00069 22.7 44/143  
:HMM:PFM   209->311 PF00884 * Sulfatase 0.00076 19.1 94/379  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35710.1 GT:GENE AAD35710.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(660146..661291) GB:FROM 660146 GB:TO 661291 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35710.1 GB:DB_XREF GI:4981147 LENGTH 381 SQ:AASEQ MNNKGKLAILFIDALPYFKSRNIGQILNLYRLIPGLGYSVNQHYELLYGKTPDDVGFFGEWSLGCSTKFDTIKFRFHKTIDSILWKLKLNLIRKGYRKIILRLEDMIPLGRRKYFLRKGTYAFRELAKEGFILYNTQFRGYIEELDRTLPRNEEKRMETMFNKMFNIAKNTDHPLLFTINIIDHIGHKYGPESPEYDYFLDLFAKKLLDLLIFLKENGFHVILFSDHGMSPYKAKVNLSDFEHYFGKFFGKYIVYFYDSLYFRAWIFDSFLYLEIEEFLNKLPGKILSSNDRKKFGVVHEEHGHVIFVLNEGFTFHPNYFGYSVMKGYHGYLPEFERQHGIAAFSRAFKIDNLFQGNPPKYLNSIDFSRIIKHILEANRNV GT:EXON 1|1-381:0| SEG 197->215|dyfldlfakklldlliflk| RP:PDB:NREP 1 RP:PDB:REP 43->356|1ei6A|6e-05|11.5|304/404| RP:PFM:NREP 1 RP:PFM:REP 182->236|PF01663|9e-07|40.0|55/308|Phosphodiest| HM:PFM:NREP 3 HM:PFM:REP 153->241|PF01663|4e-13|31.5|89/364|Phosphodiest| HM:PFM:REP 127->170|PF04099|0.00069|22.7|44/143|Sybindin| HM:PFM:REP 209->311|PF00884|0.00076|19.1|94/379|Sulfatase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF01663|IPR002591| RP:SCP:NREP 1 RP:SCP:REP 171->315|1ei6A|6e-07|16.3|141/404|c.76.1.4| HM:SCP:REP 3->375|1ei6A_|8.9e-25|24.0|329/406|c.76.1.4|1/1|Alkaline phosphatase-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 79.8 SQ:SECSTR ##########################################HHHHHHTccHHHHcccccEEEETTTTEEEEcccGGGcccccHHHH###HHHTTccEEEEEccHHHHHHHTTTcccEEEEcTTc###ccccHHHHccccHHHHHTccccccccTHHHHHHHHHHHHHHHTTcccEEEEEcccHHHHHccTTcHHH####HHHHHHHHHHHHHHHHTTcEEEEEcccccEEcccTTccccEEEHHHHHHHHHcTTcEEEEcTTccTTcccGGGcccEEEEEEcTccHHHHHHHHHTcTTEEEEEEHHHHHHHHTccGGGcccEEEEEcTTcEEccTTTccGGGcccccEEcccGGG######################### DISOP:02AL 1-4, 380-381| PSIPRED ccccccEEEEEEEcccccccccHHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHccEEEEEcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccEEEEEEHHHHccHHcccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccccccccEEEccccEEEEEcccEEEccccccHHHHHccccccccHHHHccHHHHHHHHHHcccccccccHHHHcccHHHHHHHHHHccccc //