[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35713.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:418 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   199->265 PF11377 * DUF3180 0.00025 22.4 67/138  
:HMM:PFM   41->70 PF04982 * HPP 0.0009 30.0 30/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35713.1 GT:GENE AAD35713.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(663564..664820) GB:FROM 663564 GB:TO 664820 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35713.1 GB:DB_XREF GI:4981150 LENGTH 418 SQ:AASEQ MNEMSSHMLSMEKQLYKTKRKISLENFLVNLFFVTVLFPYVTFGLPASSDSQPWAVLVGSLLLIFNLVKNRNIHFHKITLMIIFLSLICILNVTVFFIFQGGELTFYLRTIFKYINFMIIIPIVIIYFERFSPNILSFSILLWFMIVIAQVITKKVLIDFVLPRNTIVYGRNFAIGFAPEPAYMAKVCIFFLLMIDYYKNLRSIKPVKAMILTLFALVMILASASLTGFVLVIIYFLIKLFLSARKSNFGKVQKIILICVLIVTLILFLPLLMNFVTKHDFSNFGKVGYYISKMLENRSLFIFIVDQSFKSRLSGFIRNFSSFVSGNVFGSGVPIYPTGSIFSPVYDSGIFGLLFSASILSIFILSVFRIKKKKLRNYLIELFVMFIFLTFSESLATSYIAFIAGISLYLYNKVVNEF GT:EXON 1|1-418:0| TM:NTM 11 TM:REGION 23->45| TM:REGION 54->69| TM:REGION 76->98| TM:REGION 106->128| TM:REGION 142->164| TM:REGION 179->201| TM:REGION 214->236| TM:REGION 253->275| TM:REGION 321->343| TM:REGION 348->369| TM:REGION 383->405| SEG 24->38|lenflvnlffvtvlf| SEG 115->126|infmiiipivii| SEG 255->272|iilicvlivtlilflpll| SEG 319->333|nfssfvsgnvfgsgv| SEG 350->368|ifgllfsasilsifilsvf| HM:PFM:NREP 2 HM:PFM:REP 199->265|PF11377|0.00025|22.4|67/138|DUF3180| HM:PFM:REP 41->70|PF04982|0.0009|30.0|30/121|HPP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //