[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35724.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->180 2i6xA PDBj 3e-10 29.3 %
:RPS:PDB   2->193 2b0cA PDBj 8e-19 17.2 %
:RPS:SCOP  3->192 1cqzB1  c.108.1.2 * 2e-20 23.7 %
:HMM:SCOP  1->193 1vj5A1 c.108.1.2 * 1.7e-34 29.2 %
:HMM:PFM   2->176 PF00702 * Hydrolase 4.6e-15 19.0 174/192  
:BLT:SWISS 3->200 ACD10_HUMAN 1e-08 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35724.1 GT:GENE AAD35724.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 674278..674883 GB:FROM 674278 GB:TO 674883 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE similar to GB:Pyro_h percent identity: 54.14; identified by sequence similarity; putative GB:PROTEIN_ID AAD35724.1 GB:DB_XREF GI:4981162 LENGTH 201 SQ:AASEQ MIRNIVFDLGGVLIDWRPCEYLVESFPEDVAKVLEREIFKHEDWKKMDRGTLPENDLWEKKKKELSEYREYVEKLEREVPKLLKPIEENVKLLSILKEKNFKLYVLSNYGKIYFEMVRRRYRFFDFFDGMVISSHVGFIKPEKEIYLELIRKYKITPKESLFIDDMEENVKAAEELGFNTIHLPEPSRLKELLFETLKIGR GT:EXON 1|1-201:0| BL:SWS:NREP 1 BL:SWS:REP 3->200|ACD10_HUMAN|1e-08|30.1|186/1059| SEG 118->128|rrryrffdffd| BL:PDB:NREP 1 BL:PDB:REP 2->180|2i6xA|3e-10|29.3|174/199| RP:PDB:NREP 1 RP:PDB:REP 2->193|2b0cA|8e-19|17.2|192/199| HM:PFM:NREP 1 HM:PFM:REP 2->176|PF00702|4.6e-15|19.0|174/192|Hydrolase| RP:SCP:NREP 1 RP:SCP:REP 3->192|1cqzB1|2e-20|23.7|190/222|c.108.1.2| HM:SCP:REP 1->193|1vj5A1|1.7e-34|29.2|192/226|c.108.1.2|1/1|HAD-like| OP:NHOMO 133 OP:NHOMOORG 119 OP:PATTERN -------------------------------------------------------------------- 2----------------------------------------------------------------------2---222---------------111---1-----111----------------------------------------------------------------------------------1---------------------------------------------------------------1------1-1------------1---------1-------1--1---------------1------------32-------------------------1------------------1----11--------------1----11111111111----------11-111112111111------11----111----------------------------------------------1----------11-1-1------11------111---------1-------11----------------------------------------------------------------1-----------------111-------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1------------------------111111111-------------------1------------------------------------------1-11111111--- ------------------1----2111--------------------------------111----------------------------2--1-1--------------------2-----------------------------11-----1----113-11---------1-----------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 98.5 SQ:SECSTR TccEEEEcccTTTEEEETHHHHHHHHHcccHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHTccccHHHHHHHHHTcEEEEcHHHHHHHHHHHHTTcEEEEEEcccccTTcccGGGcHHHHHHccEEEEHHHHTccTTcHHHHHHHHHHTccGGGEEEEEccHHHHHHHHTTTcEEEEcccTTHHHHHHHTHHc### DISOP:02AL 201-202| PSIPRED cccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccHHHccEEEEHHHcccccccHHHHHHHHHHccccHHHEEEEcccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccc //