[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35729.1
DDBJ      :             NH(3)-dependent NAD(+) synthetase, putative
Swiss-Prot:NADE1_THEMA  RecName: Full=NH(3)-dependent NAD(+) synthetase;         EC=6.3.1.5;

Homologs  Archaea  66/68 : Bacteria  519/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:281 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->276 2e18A PDBj 9e-32 46.7 %
:RPS:PDB   37->281 1bgbB PDBj 2e-32 10.6 %
:RPS:SCOP  3->279 1ee1A  c.26.2.1 * 2e-39 25.8 %
:HMM:SCOP  3->279 1wxiA1 c.26.2.1 * 5.5e-55 39.3 %
:RPS:PFM   36->237 PF02540 * NAD_synthase 2e-25 43.3 %
:HMM:PFM   3->87 PF02540 * NAD_synthase 4.4e-25 43.5 85/242  
:HMM:PFM   138->268 PF02540 * NAD_synthase 8.9e-41 48.1 131/242  
:BLT:SWISS 1->281 NADE1_THEMA e-152 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35729.1 GT:GENE AAD35729.1 GT:PRODUCT NH(3)-dependent NAD(+) synthetase, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(679684..680529) GB:FROM 679684 GB:TO 680529 GB:DIRECTION - GB:PRODUCT NH(3)-dependent NAD(+) synthetase, putative GB:NOTE similar to GB:L77117 PID:1591995 percent identity: 61.42; identified by sequence similarity; putative GB:PROTEIN_ID AAD35729.1 GB:DB_XREF GI:4981167 LENGTH 281 SQ:AASEQ MKESLISFIKEKIEEYNYRGAVVGVSGGVDSAVVLSLCVQALGKDRVFALILPERDSSKDSLKDAVDFCERLGVEYRKRSITPILRKIGVYRLFPPRLFLPDSIVKRYVLNRWNTLSKDPFLDDLRNTGPEEFLKGLAYYRIKHRIRMCLLYFEAEKRGYAVVGTTNRTEYLTGLYVKWGDEAVDIEPIMHLYKTQVFELAKEMNVPEKILKKPPSPDLIPGITDEMAFNMSYLELDRILMKLEKNEDLSDEDPKKVERVKKILELSEKYRRDIPITFDRI GT:EXON 1|1-281:0| SW:ID NADE1_THEMA SW:DE RecName: Full=NH(3)-dependent NAD(+) synthetase; EC=6.3.1.5; SW:GN Name=nadE1; OrderedLocusNames=TM_0645; SW:KW ATP-binding; Complete proteome; Ligase; NAD; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->281|NADE1_THEMA|e-152|100.0|281/281| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 20->34|gavvgvsggvdsavv| BL:PDB:NREP 1 BL:PDB:REP 37->276|2e18A|9e-32|46.7|199/256| RP:PDB:NREP 1 RP:PDB:REP 37->281|1bgbB|2e-32|10.6|199/228| RP:PFM:NREP 1 RP:PFM:REP 36->237|PF02540|2e-25|43.3|164/208|NAD_synthase| HM:PFM:NREP 2 HM:PFM:REP 3->87|PF02540|4.4e-25|43.5|85/242|NAD_synthase| HM:PFM:REP 138->268|PF02540|8.9e-41|48.1|131/242|NAD_synthase| GO:PFM:NREP 3 GO:PFM GO:0003952|"GO:NAD+ synthase (glutamine-hydrolyzing) activity"|PF02540|IPR003694| GO:PFM GO:0005524|"GO:ATP binding"|PF02540|IPR003694| GO:PFM GO:0009435|"GO:NAD biosynthetic process"|PF02540|IPR003694| RP:SCP:NREP 1 RP:SCP:REP 3->279|1ee1A|2e-39|25.8|233/271|c.26.2.1| HM:SCP:REP 3->279|1wxiA1|5.5e-55|39.3|234/0|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 617 OP:NHOMOORG 586 OP:PATTERN 111111111111111121121221111111121111111111111111-1322111111111111-11 -1-1-111---1-11---------------------11111-1----11111111-11--11--1--11-1--------111-11111-----------1111111---1---------------11111111111---1111-11--1122----------1-1--111---1-------1-11111211111111111111111111111111111111111111111112-11111111111111111111-111111-1-11111111111111111111111111111111111111111111111111111111111-11-------------1----------1----111-1-1111---1111111-----1---1-11---------1--------------------11-11---11111111111-1-1--1---------------------11------1--------------------1-----1---1-------------21-----1-------1111111-11-1112111--1--111111111---1-----1------1---12221111-11111-1--11111111111111111111111-------1-11-11111111111111111111211-1---11--111111--111111111111-1111111111111111111111111111111111111111111-111111111---------------1111111111-1111---1-1---------111-1111-11111111212111111111111111111-11111111111111---------------------------------------1-11111-1111-1111-1112212222222--- ----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHHcTTcEEEEccccHHHHHHHHcEEcTTcEccEEcccccHHHHHHHHHHHHHHHHHHHHHHTTcEEEccccTTHHHHHHHHHHHTTcEEEcccHHHHTTcEEEcccccccEEEEccccETTcEEEEEEEEEEEcccccEEEEcccTTTcTTTTccccGGGEEEEEEEEEEEEEEEcccccEETTcGGGccccEEEEEEGGGGEEEEEEETTTTEEEEccccHHHHHHTccccccHHcccHHHHHHHHHHHHccccHHHTTccccHHH DISOP:02AL 280-281| PSIPRED cHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHcccHHHHHHHHHHHHHHcccccEEccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccHHHHccccccccccccccHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccc //