[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35733.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->64 PF01865 * PhoU_div 0.00013 23.8 63/214  
:BLT:SWISS 24->79 MURC_LEUMM 2e-04 35.7 %
:BLT:SWISS 51->121 DPO4_UREU1 2e-04 36.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35733.1 GT:GENE AAD35733.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 681943..682431 GB:FROM 681943 GB:TO 682431 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35733.1 GB:DB_XREF GI:4981171 LENGTH 162 SQ:AASEQ MKREQILSLIAEIDDLLNALNMVVKEIEEKKREFSDKEPDQFILRALGSLLHDFYTIIEDIFELISSEMNGVRLDSFDWHKRLLNKMTLEIPGLRPAVISKRLKEMLDEYLRFRHVFRNVYGYLLQWERMKPLLEKAGAVYERFEEEIERFKDFLRELAEKM GT:EXON 1|1-162:0| BL:SWS:NREP 2 BL:SWS:REP 24->79|MURC_LEUMM|2e-04|35.7|56/444| BL:SWS:REP 51->121|DPO4_UREU1|2e-04|36.4|66/360| HM:PFM:NREP 1 HM:PFM:REP 2->64|PF01865|0.00013|23.8|63/214|PhoU_div| OP:NHOMO 21 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------3-------1-212----1-------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11121-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //