[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35742.1
DDBJ      :             neelaredoxin
Swiss-Prot:SOR_THEMA    RecName: Full=Putative superoxide reductase;         Short=SOR;         EC=1.15.1.2;

Homologs  Archaea  18/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.13
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->131 2amuA PDBj 3e-76 100.0 %
:RPS:PDB   1->131 2amuA PDBj 7e-18 100.0 %
:RPS:SCOP  9->123 1dfxA1  b.1.13.1 * 1e-15 33.3 %
:HMM:SCOP  2->128 1dqiA_ b.1.13.1 * 1.7e-36 40.3 %
:RPS:PFM   11->123 PF01880 * Desulfoferrodox 6e-12 51.1 %
:HMM:PFM   10->123 PF01880 * Desulfoferrodox 1.7e-34 48.9 94/96  
:BLT:SWISS 1->131 SOR_THEMA 8e-76 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35742.1 GT:GENE AAD35742.1 GT:PRODUCT neelaredoxin GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 688787..689182 GB:FROM 688787 GB:TO 689182 GB:DIRECTION + GB:PRODUCT neelaredoxin GB:NOTE similar to GP:2654185 percent identity: 71.54; identified by sequence similarity; putative GB:PROTEIN_ID AAD35742.1 GB:DB_XREF GI:4981181 LENGTH 131 SQ:AASEQ MKLSDFIKTEDFKKEKHVPVIEAPEKVKKDEKVQIVVTVGKEIPHPNTTEHHIRWIKVFFQPDGDPYVYEVGRYEFNAHGESVQGPNIGAVYTEPTVTTVVKLNRSGTIIALSYCNIHGLWESSQKITVEE GT:EXON 1|1-131:0| SW:ID SOR_THEMA SW:DE RecName: Full=Putative superoxide reductase; Short=SOR; EC=1.15.1.2; SW:GN OrderedLocusNames=TM_0658; SW:KW 3D-structure; Complete proteome; Electron transport; Iron;Metal-binding; Oxidoreductase; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|SOR_THEMA|8e-76|100.0|131/131| GO:SWS:NREP 5 GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 1->131|2amuA|3e-76|100.0|131/132| RP:PDB:NREP 1 RP:PDB:REP 1->131|2amuA|7e-18|100.0|131/132| RP:PFM:NREP 1 RP:PFM:REP 11->123|PF01880|6e-12|51.1|90/93|Desulfoferrodox| HM:PFM:NREP 1 HM:PFM:REP 10->123|PF01880|1.7e-34|48.9|94/96|Desulfoferrodox| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01880|IPR002742| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01880|IPR002742| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01880|IPR002742| RP:SCP:NREP 1 RP:SCP:REP 9->123|1dfxA1|1e-15|33.3|84/89|b.1.13.1| HM:SCP:REP 2->128|1dqiA_|1.7e-36|40.3|124/0|b.1.13.1|1/1|Superoxide reductase-like| OP:NHOMO 38 OP:NHOMOORG 36 OP:PATTERN --1111----------1------1------------1------------2--1-1111111---11-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------11-----------------------11---------------111-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 100.0 SQ:SECSTR ccGGGGEEcccTTTcTTcEEEEcccEEETTcEEEEEEEEcccccccccccccEEEEEEEEEETTccccEEEEEEEcccccccTTcTTccccccccEEEEEEEccccEEEEEEEEETTTEEEEEEEEEEEEc DISOP:02AL 1-6, 8-11| PSIPRED cccHHHHccccccccccccEEEcHHHHcccccEEEEEEEccEEccccccccEEEEEEEEEcccccccEEEEEEEEccccccccccccccccccccEEEEEEcccccEEEEEEEEEccccEEccEEEEEEEc //