[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35746.1
DDBJ      :             acyl carrier protein
Swiss-Prot:ACP_THEMA    RecName: Full=Acyl carrier protein;         Short=ACP;

Homologs  Archaea  0/68 : Bacteria  686/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:81 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->81 2ehtA PDBj 5e-23 55.6 %
:RPS:PDB   2->77 3ejbA PDBj 2e-16 46.1 %
:RPS:SCOP  5->77 1f80D  a.28.1.1 * 6e-17 50.7 %
:HMM:SCOP  2->80 1klpA_ a.28.1.1 * 1.3e-21 41.8 %
:RPS:PFM   11->76 PF00550 * PP-binding 1e-04 38.5 %
:HMM:PFM   10->76 PF00550 * PP-binding 1.5e-18 34.8 66/67  
:BLT:SWISS 1->81 ACP_THEMA 3e-40 100.0 %
:PROS 35->50|PS00012|PHOSPHOPANTETHEINE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35746.1 GT:GENE AAD35746.1 GT:PRODUCT acyl carrier protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(691234..691479) GB:FROM 691234 GB:TO 691479 GB:DIRECTION - GB:PRODUCT acyl carrier protein GB:NOTE similar to GB:AE000657 percent identity: 86.30; identified by sequence similarity; putative GB:PROTEIN_ID AAD35746.1 GB:DB_XREF GI:4981185 LENGTH 81 SQ:AASEQ MASREEIFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFESEFGVKVDDADLEKISTVGDIVSYIEKKLG GT:EXON 1|1-81:0| SW:ID ACP_THEMA SW:DE RecName: Full=Acyl carrier protein; Short=ACP; SW:GN Name=acpP; OrderedLocusNames=TM_0662; SW:KW Complete proteome; Cytoplasm; Fatty acid biosynthesis;Lipid synthesis; Phosphopantetheine. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->81|ACP_THEMA|3e-40|100.0|81/81| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| PROS 35->50|PS00012|PHOSPHOPANTETHEINE|PDOC00012| BL:PDB:NREP 1 BL:PDB:REP 10->81|2ehtA|5e-23|55.6|72/77| RP:PDB:NREP 1 RP:PDB:REP 2->77|3ejbA|2e-16|46.1|76/78| RP:PFM:NREP 1 RP:PFM:REP 11->76|PF00550|1e-04|38.5|65/67|PP-binding| HM:PFM:NREP 1 HM:PFM:REP 10->76|PF00550|1.5e-18|34.8|66/67|PP-binding| GO:PFM:NREP 1 GO:PFM GO:0048037|"GO:cofactor binding"|PF00550|IPR006163| RP:SCP:NREP 1 RP:SCP:REP 5->77|1f80D|6e-17|50.7|73/74|a.28.1.1| HM:SCP:REP 2->80|1klpA_|1.3e-21|41.8|79/115|a.28.1.1|1/1|ACP-like| OP:NHOMO 847 OP:NHOMOORG 728 OP:PATTERN -------------------------------------------------------------------- 1111---11111--11111-1111111111111111111112121-11----111-111111---111111-------1---11111111111-1111-11211111111111111111111111111111111111111111111-1-211-11111111111111-1211111111111111111111121-111111111111111--11--1111111111111111---111111111111111111121121121121112211211--11111111222222-----------1222112112211222112222211211222222222212112111--1-11221111111-11111111-11112111111111111111111111111111111112-111111111111-2-1111111421121111111111111111111111111111------------11111111111111111111211111111112111111111211111111121111111121111111111111111-111111111111111111112--1-1111---1-11111111-121-111111111111112111121111111111---1--11-1------1------1---11-1111-----------1-------------------------------------111111111111111111---111--1-1--------------11111112111--------------------11111111111111111---111111-1-2111111111-221111111111111--------11111111111111111111111-1-111---------------------2212211122111 11------311------------------------------------------------111------------1--------11---------1-111----113-171---------------------------------------------------1-----2-2---122111F1--215442-121-----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 100.0 SQ:SECSTR ccccccHHHHHHHHHHHHccccTTTccTTccTTTTTcccTTHHHHHHHHHHHHTTccccHHHHHHcccHHHHHHHHHHccc DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHcccHHHccccccHHHHHcccHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHHcc //