[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35752.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:156 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  59->124 1j6pA2  c.1.9.9 * 7e-05 28.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35752.1 GT:GENE AAD35752.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(697589..698059) GB:FROM 697589 GB:TO 698059 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by sequence similarity; putative GB:PROTEIN_ID AAD35752.1 GB:DB_XREF GI:4981191 LENGTH 156 SQ:AASEQ MDRIPVIKRSGEVLYIDRKSIKSYVDRFLSSQSDEQYFYVSDLKISSSGKRYRVEIVLKDPHGKIFSGESEGPRTSRNLLKLIGEAATEAFNRAFHKYDEVSVDDIKEVALAGRRFVFAHLTFLKNGKESWRIGAAPLEKDLLQSVVFAVIDALVK GT:EXON 1|1-156:0| RP:SCP:NREP 1 RP:SCP:REP 59->124|1j6pA2|7e-05|28.6|63/281|c.1.9.9| OP:NHOMO 12 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1121222--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccEEEccccEEEEEHHHHHHHHHHcccccccEEEEEEEEEEEEccccEEEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccEEEEccEEEEEEccEEEEEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHcc //