[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35777.1
DDBJ      :             ATP-dependent Clp protease, proteolytic subunit
Swiss-Prot:CLPP_THESQ   RecName: Full=ATP-dependent Clp protease proteolytic subunit;         EC=3.4.21.92;AltName: Full=Endopeptidase Clp;

Homologs  Archaea  0/68 : Bacteria  885/915 : Eukaryota  148/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->202 1yg6B PDBj 3e-64 55.8 %
:RPS:PDB   27->203 2cbyB PDBj 2e-58 45.5 %
:RPS:SCOP  25->202 1tg6A1  c.14.1.1 * 8e-36 52.2 %
:HMM:SCOP  19->203 2f6iA1 c.14.1.1 * 6.7e-81 62.5 %
:RPS:PFM   28->199 PF00574 * CLP_protease 7e-71 69.8 %
:HMM:PFM   24->201 PF00574 * CLP_protease 6.2e-89 70.8 178/182  
:BLT:SWISS 1->203 CLPP_THESQ e-103 100.0 %
:PROS 99->110|PS00381|CLP_PROTEASE_SER
:PROS 121->134|PS00382|CLP_PROTEASE_HIS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35777.1 GT:GENE AAD35777.1 GT:PRODUCT ATP-dependent Clp protease, proteolytic subunit GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 719470..720081 GB:FROM 719470 GB:TO 720081 GB:DIRECTION + GB:PRODUCT ATP-dependent Clp protease, proteolytic subunit GB:NOTE similar to GB:AE000657 percent identity: 86.07; identified by sequence similarity; putative GB:PROTEIN_ID AAD35777.1 GB:DB_XREF GI:4981218 LENGTH 203 SQ:AASEQ MTVKEKKIIDQYVPIVVESTGRYERAYDIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAEDPDKDVYLYINSPGGSVTAGLAIYDTMQYIKCDVSTICVGQAASMAAVLLAAGAKGKRYALPNARIMIHQPLGGAEGPAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDTDRDFFMSAEEAKEYGIVDKVVSTRE GT:EXON 1|1-203:0| SW:ID CLPP_THESQ SW:DE RecName: Full=ATP-dependent Clp protease proteolytic subunit; EC=3.4.21.92;AltName: Full=Endopeptidase Clp; SW:GN Name=clpP; OrderedLocusNames=TRQ2_0233; SW:KW ATP-binding; Complete proteome; Cytoplasm; Hydrolase;Nucleotide-binding; Protease; Serine protease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->203|CLPP_THESQ|e-103|100.0|203/203| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0008236|"GO:serine-type peptidase activity"|Serine protease| PROS 99->110|PS00381|CLP_PROTEASE_SER|PDOC00358| PROS 121->134|PS00382|CLP_PROTEASE_HIS|PDOC00358| SEG 105->120|aasmaavllaagakgk| BL:PDB:NREP 1 BL:PDB:REP 13->202|1yg6B|3e-64|55.8|190/192| RP:PDB:NREP 1 RP:PDB:REP 27->203|2cbyB|2e-58|45.5|167/170| RP:PFM:NREP 1 RP:PFM:REP 28->199|PF00574|7e-71|69.8|172/179|CLP_protease| HM:PFM:NREP 1 HM:PFM:REP 24->201|PF00574|6.2e-89|70.8|178/182|CLP_protease| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00574|IPR001907| GO:PFM GO:0006508|"GO:proteolysis"|PF00574|IPR001907| RP:SCP:NREP 1 RP:SCP:REP 25->202|1tg6A1|8e-36|52.2|178/184|c.14.1.1| HM:SCP:REP 19->203|2f6iA1|6.7e-81|62.5|184/0|c.14.1.1|1/1|ClpP/crotonase| OP:NHOMO 1698 OP:NHOMOORG 1033 OP:PATTERN -------------------------------------------------------------------- 1112422222222222222-222222222222222244442445442222222222242233423225532222222211121111111111111121-111122111222222222222222221111111111122222111113443444334444444444324444444444444444111111122112222222222332222222112221111111222222332111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111211111111211211111121111211112211111111111111111211121111111221111111111111111111211121111122213332332333331122111211111112222222222221121111111111111111111111111111111111111111211111111111112211111121211111111111111211121111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111221111111111--1111111111111111111111111111111111111111112111111111111111111111111111111111121211111111111111111111111111111222211111111111111111111111111111111111111211111111111111112222222222222222--------------------------1111111111121 22----122---1111111111111111111111111111111-1111111111111111111----------1---------------1211111111111-111-1D-21111211-1--111-11-151-11111--11111-1-111-1-1--111111111-111512225866*78979JDKL19C6631117 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 100.0 SQ:SECSTR HcEETTTTEEcEEETTTcccccccccHHHHHHHHHTTEEEEcccccHHHHHHHHHHHHHHHHHcTTccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEETHHHHHHHTccTTcEEEcTTcEEEcccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHTTcEEEHHHHHHHTcccEEccccc DISOP:02AL 1-9, 202-203| PSIPRED ccccccccccccccEEEEccccccccHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccccEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHcccHHHHccccc //