[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35800.1
DDBJ      :             purine-binding chemotaxis protein
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  409/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.7
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->135 2qdlB PDBj 2e-19 34.1 %
:RPS:PDB   4->144 2ch4W PDBj 9e-21 30.4 %
:RPS:SCOP  4->144 2ch4W1  b.40.7.1 * 6e-21 30.4 %
:HMM:SCOP  4->148 1k0sA_ b.40.7.1 * 2.7e-33 37.4 %
:RPS:PFM   7->139 PF01584 * CheW 1e-08 27.5 %
:HMM:PFM   7->142 PF01584 * CheW 1.5e-37 32.6 135/138  
:BLT:SWISS 4->150 CHEW_TREPA 4e-19 27.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35800.1 GT:GENE AAD35800.1 GT:PRODUCT purine-binding chemotaxis protein GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION 741130..741588 GB:FROM 741130 GB:TO 741588 GB:DIRECTION + GB:PRODUCT purine-binding chemotaxis protein GB:NOTE similar to GB:M13462 SP:P07365 PID:145520 GB:U00096 PID:1736540 percent identity: 61.43; identified by sequence similarity; putative GB:PROTEIN_ID AAD35800.1 GB:DB_XREF GI:4981243 LENGTH 152 SQ:AASEQ MKMELKVVTFKLGNQVFGVDIMKVESIVEVEKIVPVPETAEYIEGVMNLRGKIIPVVNLRKKFKMPDMEDKKRAKIIVSMVKNTLIGFLVDDVSEVLTLTESDIEQPPQNLAGKGKNYILGLAKVRDDIVIILNIEEVLTSEELVEISNINV GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 4->150|CHEW_TREPA|4e-19|27.9|147/170| SEG 23->38|kvesivevekivpvpe| BL:PDB:NREP 1 BL:PDB:REP 3->135|2qdlB|2e-19|34.1|132/146| RP:PDB:NREP 1 RP:PDB:REP 4->144|2ch4W|9e-21|30.4|138/139| RP:PFM:NREP 1 RP:PFM:REP 7->139|PF01584|1e-08|27.5|131/135|CheW| HM:PFM:NREP 1 HM:PFM:REP 7->142|PF01584|1.5e-37|32.6|135/138|CheW| GO:PFM:NREP 4 GO:PFM GO:0004871|"GO:signal transducer activity"|PF01584|IPR002545| GO:PFM GO:0005622|"GO:intracellular"|PF01584|IPR002545| GO:PFM GO:0006935|"GO:chemotaxis"|PF01584|IPR002545| GO:PFM GO:0007165|"GO:signal transduction"|PF01584|IPR002545| RP:SCP:NREP 1 RP:SCP:REP 4->144|2ch4W1|6e-21|30.4|138/139|b.40.7.1| HM:SCP:REP 4->148|1k0sA_|2.7e-33|37.4|139/0|b.40.7.1|1/1|CheW-like| OP:NHOMO 830 OP:NHOMOORG 426 OP:PATTERN -----------------------1--------------1111211--2-1212-1-1-11-------- 121-----------------------------------------2---1------------------------------------1-1--------------------1-------------------------------------------------------------1---------------------22----11111111111-2222211121222-111111121------------------------------------------------------------------------------------------54325111111111141221---217--22-3233321331212244---12-2221-----1134411135115------------------------4225443444331-2---1-222211---------1--1--21-----------------------------------11111------3111111111111111-12222--111311111--42143-112431--------11-12252212433D233317875699444414-111-222-2222221111111113321---44-2232112-3333332233324433234----122------11111111111111111-1111111111111111111---11--111111111111111111-1-11111--11111111111---------------315--------------------------233333235222231333---------2322122222112221-12223122------124422223333333311--------------------------2-22221222-3- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 93.4 SQ:SECSTR ##cEEEEEEEEcTTccEEEcTTTEEEEEEcccccccccccTTEEEEEEETTEEEEEEEHHHHHTcccccTTTccEEEEEEccccEEEEEEcEEEEEEEEETTTccccTTTcTcccTTTEEEEccccccccEEEcHHHHHHHHHc######## DISOP:02AL 1-2, 151-152| PSIPRED cccEEEEEEEEEccEEEEEEHHHcEEEEccccccccccccHHHEEHEccccEEEEEEEHHHHccccccccccccEEEEEEEccEEEEEEEEccccEEEccHHHHHccccccccccccEEEEEEEEccEEEEEEEHHHHccHHHHHHHHcccc //