[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35822.1
DDBJ      :             lipopolysaccharide core biosynthesis protein KdtB
Swiss-Prot:COAD_THESQ   RecName: Full=Phosphopantetheine adenylyltransferase;         EC=2.7.7.3;AltName: Full=Pantetheine-phosphate adenylyltransferase;         Short=PPAT;AltName: Full=Dephospho-CoA pyrophosphorylase;

Homologs  Archaea  0/68 : Bacteria  856/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->158 1vlhB PDBj 2e-87 100.0 %
:RPS:PDB   2->156 1b6tA PDBj 5e-33 49.0 %
:RPS:SCOP  2->156 1b6tA  c.26.1.3 * 6e-33 49.0 %
:HMM:SCOP  1->159 1b6tA_ c.26.1.3 * 1.3e-45 42.0 %
:RPS:PFM   4->117 PF01467 * CTP_transf_2 9e-14 38.6 %
:HMM:PFM   4->132 PF01467 * CTP_transf_2 4.2e-21 27.1 129/157  
:BLT:SWISS 1->161 COAD_THESQ 8e-89 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35822.1 GT:GENE AAD35822.1 GT:PRODUCT lipopolysaccharide core biosynthesis protein KdtB GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(765524..766009) GB:FROM 765524 GB:TO 766009 GB:DIRECTION - GB:PRODUCT lipopolysaccharide core biosynthesis protein KdtB GB:NOTE similar to SP:P23875 GB:M60670 GB:M86305 PID:146544 PID:146557 percent identity: 71.61; identified by sequence similarity; putative GB:PROTEIN_ID AAD35822.1 GB:DB_XREF GI:4981266 LENGTH 161 SQ:AASEQ MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMFTLEERKKLIEEVLSDLDGVKVDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLKEGKR GT:EXON 1|1-161:0| SW:ID COAD_THESQ SW:DE RecName: Full=Phosphopantetheine adenylyltransferase; EC=2.7.7.3;AltName: Full=Pantetheine-phosphate adenylyltransferase; Short=PPAT;AltName: Full=Dephospho-CoA pyrophosphorylase; SW:GN Name=coaD; OrderedLocusNames=TRQ2_0186; SW:KW ATP-binding; Coenzyme A biosynthesis; Complete proteome; Cytoplasm;Nucleotide-binding; Nucleotidyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->161|COAD_THESQ|8e-89|100.0|161/161| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0015937|"GO:coenzyme A biosynthetic process"|Coenzyme A biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->158|1vlhB|2e-87|100.0|158/158| RP:PDB:NREP 1 RP:PDB:REP 2->156|1b6tA|5e-33|49.0|155/157| RP:PFM:NREP 1 RP:PFM:REP 4->117|PF01467|9e-14|38.6|114/145|CTP_transf_2| HM:PFM:NREP 1 HM:PFM:REP 4->132|PF01467|4.2e-21|27.1|129/157|CTP_transf_2| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF01467|IPR004820| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01467|IPR004820| RP:SCP:NREP 1 RP:SCP:REP 2->156|1b6tA|6e-33|49.0|155/157|c.26.1.3| HM:SCP:REP 1->159|1b6tA_|1.3e-45|42.0|157/0|c.26.1.3|1/1|Nucleotidylyl transferase| OP:NHOMO 864 OP:NHOMOORG 857 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111-111111111111111111111111---11111111111---------------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111221121111111111111111111111111111111111111111111111111111111111-111111--11111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------1-111------11-11---1112111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 98.8 SQ:SECSTR cEEEEEEccTTccHHHHHHHHHHHHHccEEEEEEEccccccccccHHHHHHHHHHHTTTcTTEEEEEEcccHHHHHHHTTccEEEEEccTTccHHHHHHHHHHHHHHcTTcEEEEEcccGGGTTccHHHHHHHHHTTcccGGGccHHHHHHHHHHHTcc## DISOP:02AL 158-161| PSIPRED cEEEEEcccccccHHHHHHHHHHHHHccEEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHccccHHcccHHHHHHHHHHHHcccc //