[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermotoga maritima MSB8 (tmar0)
Gene : AAD35835.1
DDBJ      :             ubiquinone/menaquinone biosynthesis methyltransferase, putative
Swiss-Prot:UBIE_THEMA   RecName: Full=Menaquinone biosynthesis methyltransferase ubiE;         EC=2.1.1.-;

Homologs  Archaea  15/68 : Bacteria  745/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:229 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->125 3dtnA PDBj 3e-08 29.8 %
:RPS:PDB   13->210 3e05B PDBj 2e-21 10.8 %
:RPS:SCOP  13->210 2gh1A1  c.66.1.49 * 4e-20 16.9 %
:HMM:SCOP  9->210 1wznA1 c.66.1.43 * 4.2e-49 35.9 %
:RPS:PFM   12->209 PF01209 * Ubie_methyltran 4e-39 42.3 %
:HMM:PFM   8->225 PF01209 * Ubie_methyltran 2.4e-54 39.2 217/233  
:BLT:SWISS 1->229 UBIE_THEMA e-121 100.0 %
:PROS 20->35|PS01183|UBIE_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAD35835.1 GT:GENE AAD35835.1 GT:PRODUCT ubiquinone/menaquinone biosynthesis methyltransferase, putative GT:DATABASE GIB00025CH01 GT:ORG tmar0 GB:ACCESSION GIB00025CH01 GB:LOCATION complement(775962..776651) GB:FROM 775962 GB:TO 776651 GB:DIRECTION - GB:PRODUCT ubiquinone/menaquinone biosynthesis methyltransferase, putative GB:NOTE similar to GB:M80245 SP:P31113 PID:143802 GB:AL009126 percent identity: 54.84; identified by sequence similarity; putative GB:PROTEIN_ID AAD35835.1 GB:DB_XREF GI:4981280 LENGTH 229 SQ:AASEQ MGGKTKKHAMRLFDRIAEKYDLLNRILSFGMDTKWRKRVVELILEVNPEKVLDLATGTGDVARLLKRKAPHLEITGLDSSSKMLEIAEKRLKDGEFIVGDAHNLPFYDRSFDAITVAFGFRNFSDRRRVLRECRRVLKRKGRLVILELLPPNTKRFTGKIYSFYLKTWVPFVGGLFSGDFHAYRYLSTSVLNFLTPDQIVEMMKEEGFEVSFEPLFFSVAGIFIGDLIW GT:EXON 1|1-229:0| SW:ID UBIE_THEMA SW:DE RecName: Full=Menaquinone biosynthesis methyltransferase ubiE; EC=2.1.1.-; SW:GN Name=ubiE; OrderedLocusNames=TM_0753; SW:KW Complete proteome; Menaquinone biosynthesis; Methyltransferase;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->229|UBIE_THEMA|e-121|100.0|229/229| GO:SWS:NREP 3 GO:SWS GO:0009234|"GO:menaquinone biosynthetic process"|Menaquinone biosynthesis| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 20->35|PS01183|UBIE_1|PDOC00911| TM:NTM 2 TM:REGION 156->178| TM:REGION 208->229| SEG 126->140|rrrvlrecrrvlkrk| BL:PDB:NREP 1 BL:PDB:REP 11->125|3dtnA|3e-08|29.8|114/220| RP:PDB:NREP 1 RP:PDB:REP 13->210|3e05B|2e-21|10.8|176/192| RP:PFM:NREP 1 RP:PFM:REP 12->209|PF01209|4e-39|42.3|196/234|Ubie_methyltran| HM:PFM:NREP 1 HM:PFM:REP 8->225|PF01209|2.4e-54|39.2|217/233|Ubie_methyltran| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 13->210|2gh1A1|4e-20|16.9|183/281|c.66.1.49| HM:SCP:REP 9->210|1wznA1|4.2e-49|35.9|198/0|c.66.1.43|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1044 OP:NHOMOORG 926 OP:PATTERN ------1-2111111--------1---------------------------------2-21-111--- 1121111111111111111-111111111111111111111-1-111111111111111111111111111--------1111112111111-111-1111111111111111111111111111111111111111111133311112111111111111-1112122221-21111-112111111---21122212122122212211111122211111111111111111111111111111111111--1----11-11111-----11--12-----------------------------------------------12------------11---------1--1111111---11-----1-111111111111112111111111111111111111-1111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111112111112121111211111111111111112111211111121111113111111111111111111111111111111111111121111111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1----111111111111111211111111111111111111111111111111111111111111111111111111111112222-----------------------------------------1-111111 11-111--311--11111111111111111111111-1111111-111111111-11----1111-1111111111111111111111-1211111111111-112---121211111-1-11111--12B1-11211--11-1111-1-11-1-21111--11111111-11112213Q3332221121222221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 229 STR:RPRED 100.0 SQ:SECSTR TTEEEEcTTccEcccccccGGGccccTTTcccHHHHHHHHHHTTccTTcEEEEETcTTcHHHHHHHHHcTTcEEEEEEccHHHHHHHHHHHHHHTTEEEEEccTTTTcTTcccccEEEEcccTTcHHHHHHHHHHHccTTcEEEEEEccHHHHHHHHHHHHHTTcEEEEcccccTTccEEEcTTHHHHcccEEEccEEccccccccccEEEEEEccccHHHHEEEccHH DISOP:02AL 1-6, 8-9| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccccEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccEEEEEEEEEEEEEEEEEEEcc //